Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263083 261 bp mRNA linear INV 02-SEP-2023 (LOC106095754), transcript variant X2, mRNA. ACCESSION XM_013263083 VERSION XM_013263083.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263083.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..261 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..261 /gene="LOC106095754" /note="uncharacterized LOC106095754; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095754" CDS 97..261 /gene="LOC106095754" /codon_start=1 /product="uncharacterized protein LOC106095754" /protein_id="XP_013118537.1" /db_xref="GeneID:106095754" /translation="MAGSAVARLASKYGAVIFFPSFTAATIFADWSHTQNWKKTQREI AKVQELLKHQ" ORIGIN 1 ctcagtaaaa gttgacttcg acttttttaa tcgatttgtc gtaagtcgaa ttttagaccc 61 tattttatat cccattattc tcataaggtt gcgttcatgg ccggtagtgc tgttgcacgt 121 ctggcatcga aatacggagc ggttatattc tttccttcat tcactgcagc tactattttt 181 gccgattggt ctcataccca gaactggaag aagactcaaa gggaaatcgc taaagtacaa 241 gaacttttaa agcatcaata g