Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095754


LOCUS       XM_013263083             261 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095754), transcript variant X2, mRNA.
ACCESSION   XM_013263083
VERSION     XM_013263083.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263083.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..261
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..261
                     /gene="LOC106095754"
                     /note="uncharacterized LOC106095754; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106095754"
     CDS             97..261
                     /gene="LOC106095754"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095754"
                     /protein_id="XP_013118537.1"
                     /db_xref="GeneID:106095754"
                     /translation="MAGSAVARLASKYGAVIFFPSFTAATIFADWSHTQNWKKTQREI
                     AKVQELLKHQ"
ORIGIN      
        1 ctcagtaaaa gttgacttcg acttttttaa tcgatttgtc gtaagtcgaa ttttagaccc
       61 tattttatat cccattattc tcataaggtt gcgttcatgg ccggtagtgc tgttgcacgt
      121 ctggcatcga aatacggagc ggttatattc tttccttcat tcactgcagc tactattttt
      181 gccgattggt ctcataccca gaactggaag aagactcaaa gggaaatcgc taaagtacaa
      241 gaacttttaa agcatcaata g