Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013263082 251 bp mRNA linear INV 02-SEP-2023 beta subcomplex subunit 1 (LOC106095753), mRNA. ACCESSION XM_013263082 VERSION XM_013263082.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013263082.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..251 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..251 /gene="LOC106095753" /note="NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106095753" CDS 1..165 /gene="LOC106095753" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1" /protein_id="XP_013118536.1" /db_xref="GeneID:106095753" /translation="MVLGIDKRYVWGVLPFIGFAIGHFLDKKETERMTMFRDKSVLYG RPGGRAQPTW" misc_feature 1..162 /gene="LOC106095753" /note="MNLL subunit; Region: NADH_oxidored; pfam08040" /db_xref="CDD:462345" polyA_site 251 /gene="LOC106095753" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggttttgg gtatcgataa acgttacgtc tggggagtgc ttcccttcat tggttttgcc 61 attggtcatt tcttagacaa aaaggaaact gaacgcatga ccatgttcag agacaaaagt 121 gtcctgtacg gtcgaccagg tggaagggcg cagccaactt ggtaaacgat tataatctta 181 taatttcatt attataataa tacaatttca aaataatgaa accttcgaaa taaaaataaa 241 cttcgcttaa a