Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NADH dehydrogenase [ubiquinone] 1


LOCUS       XM_013263082             251 bp    mRNA    linear   INV 02-SEP-2023
            beta subcomplex subunit 1 (LOC106095753), mRNA.
ACCESSION   XM_013263082
VERSION     XM_013263082.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013263082.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..251
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..251
                     /gene="LOC106095753"
                     /note="NADH dehydrogenase [ubiquinone] 1 beta subcomplex
                     subunit 1; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 Proteins"
                     /db_xref="GeneID:106095753"
     CDS             1..165
                     /gene="LOC106095753"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 beta
                     subcomplex subunit 1"
                     /protein_id="XP_013118536.1"
                     /db_xref="GeneID:106095753"
                     /translation="MVLGIDKRYVWGVLPFIGFAIGHFLDKKETERMTMFRDKSVLYG
                     RPGGRAQPTW"
     misc_feature    1..162
                     /gene="LOC106095753"
                     /note="MNLL subunit; Region: NADH_oxidored; pfam08040"
                     /db_xref="CDD:462345"
     polyA_site      251
                     /gene="LOC106095753"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggttttgg gtatcgataa acgttacgtc tggggagtgc ttcccttcat tggttttgcc
       61 attggtcatt tcttagacaa aaaggaaact gaacgcatga ccatgttcag agacaaaagt
      121 gtcctgtacg gtcgaccagg tggaagggcg cagccaactt ggtaaacgat tataatctta
      181 taatttcatt attataataa tacaatttca aaataatgaa accttcgaaa taaaaataaa
      241 cttcgcttaa a