Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mpv17-like protein (LOC106095674),


LOCUS       XM_013262966             702 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X6, mRNA.
ACCESSION   XM_013262966
VERSION     XM_013262966.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262966.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..702
                     /gene="LOC106095674"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106095674"
     CDS             75..665
                     /gene="LOC106095674"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095674 isoform X4"
                     /protein_id="XP_013118420.2"
                     /db_xref="GeneID:106095674"
                     /translation="MSTLLQNFKVLITKYPITRGMISYSLIWPVSSLVQQTFEGKTWG
                     NYDWWRCLRFSLYGGLFVAPTLYGWIKVSSAMWPQTSIRTALAKAAVETISYTPGAMT
                     CFYFIMSLLEMKTIEEAASEVRKKFLPTYKVGASVWPVVATINFSVIPEKNRVLFISV
                     CSLIWTCFLAYMKHLQHHEMNEEDGFIVTKKTKENS"
     polyA_site      702
                     /gene="LOC106095674"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttgtgaca aaacaccgac aatttgccca cgaaaattgg caaacatttt atagggaagc
       61 tccaaatagc cgccatgtct acacttttgc aaaatttcaa agtattaatc accaaatatc
      121 ccatcacaag aggcatgatt tcatacagtc tgatatggcc cgtaagtagt ctggtccaac
      181 agacatttga gggcaaaact tggggtaatt atgactggtg gcgttgttta cgtttcagtt
      241 tgtatggagg tctctttgtc gcccctacgc tgtatggttg gattaaggtt tcttcagcca
      301 tgtggcctca gacatcaatt cgaacggctt tagctaaggc agctgtcgag acaatatcct
      361 atacaccagg agccatgact tgtttctact tcatcatgag tttgttggag atgaaaacca
      421 tagaagaggc agcttctgaa gttcgtaaga aatttctacc cacctataag gttggcgctt
      481 cagtgtggcc tgttgtggcc actatcaact tttctgttat cccagagaaa aatcgtgtgc
      541 tattcataag tgtttgtagt ttaatatgga cctgcttttt ggcctacatg aaacatctgc
      601 agcatcatga aatgaatgaa gaggatggat ttatagtaac aaagaaaaca aaggaaaatt
      661 catgattgtc cccgacgaaa agatattttt tgtttttttt tt