Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262966 702 bp mRNA linear INV 02-SEP-2023 transcript variant X6, mRNA. ACCESSION XM_013262966 VERSION XM_013262966.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262966.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..702 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..702 /gene="LOC106095674" /note="mpv17-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106095674" CDS 75..665 /gene="LOC106095674" /codon_start=1 /product="uncharacterized protein LOC106095674 isoform X4" /protein_id="XP_013118420.2" /db_xref="GeneID:106095674" /translation="MSTLLQNFKVLITKYPITRGMISYSLIWPVSSLVQQTFEGKTWG NYDWWRCLRFSLYGGLFVAPTLYGWIKVSSAMWPQTSIRTALAKAAVETISYTPGAMT CFYFIMSLLEMKTIEEAASEVRKKFLPTYKVGASVWPVVATINFSVIPEKNRVLFISV CSLIWTCFLAYMKHLQHHEMNEEDGFIVTKKTKENS" polyA_site 702 /gene="LOC106095674" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtttgtgaca aaacaccgac aatttgccca cgaaaattgg caaacatttt atagggaagc 61 tccaaatagc cgccatgtct acacttttgc aaaatttcaa agtattaatc accaaatatc 121 ccatcacaag aggcatgatt tcatacagtc tgatatggcc cgtaagtagt ctggtccaac 181 agacatttga gggcaaaact tggggtaatt atgactggtg gcgttgttta cgtttcagtt 241 tgtatggagg tctctttgtc gcccctacgc tgtatggttg gattaaggtt tcttcagcca 301 tgtggcctca gacatcaatt cgaacggctt tagctaaggc agctgtcgag acaatatcct 361 atacaccagg agccatgact tgtttctact tcatcatgag tttgttggag atgaaaacca 421 tagaagaggc agcttctgaa gttcgtaaga aatttctacc cacctataag gttggcgctt 481 cagtgtggcc tgttgtggcc actatcaact tttctgttat cccagagaaa aatcgtgtgc 541 tattcataag tgtttgtagt ttaatatgga cctgcttttt ggcctacatg aaacatctgc 601 agcatcatga aatgaatgaa gaggatggat ttatagtaac aaagaaaaca aaggaaaatt 661 catgattgtc cccgacgaaa agatattttt tgtttttttt tt