Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mpv17-like protein (LOC106095674),


LOCUS       XM_013262965             721 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X5, mRNA.
ACCESSION   XM_013262965
VERSION     XM_013262965.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262965.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..721
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..721
                     /gene="LOC106095674"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106095674"
     CDS             94..684
                     /gene="LOC106095674"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095674 isoform X4"
                     /protein_id="XP_013118419.2"
                     /db_xref="GeneID:106095674"
                     /translation="MSTLLQNFKVLITKYPITRGMISYSLIWPVSSLVQQTFEGKTWG
                     NYDWWRCLRFSLYGGLFVAPTLYGWIKVSSAMWPQTSIRTALAKAAVETISYTPGAMT
                     CFYFIMSLLEMKTIEEAASEVRKKFLPTYKVGASVWPVVATINFSVIPEKNRVLFISV
                     CSLIWTCFLAYMKHLQHHEMNEEDGFIVTKKTKENS"
     polyA_site      721
                     /gene="LOC106095674"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tctacaaatc acctttgaaa ataaaaacat agtgatcaaa aagtcaaaag tgaacaaaat
       61 atcaatcaag caaaaacatc tttgtaagcc gccatgtcta cacttttgca aaatttcaaa
      121 gtattaatca ccaaatatcc catcacaaga ggcatgattt catacagtct gatatggccc
      181 gtaagtagtc tggtccaaca gacatttgag ggcaaaactt ggggtaatta tgactggtgg
      241 cgttgtttac gtttcagttt gtatggaggt ctctttgtcg cccctacgct gtatggttgg
      301 attaaggttt cttcagccat gtggcctcag acatcaattc gaacggcttt agctaaggca
      361 gctgtcgaga caatatccta tacaccagga gccatgactt gtttctactt catcatgagt
      421 ttgttggaga tgaaaaccat agaagaggca gcttctgaag ttcgtaagaa atttctaccc
      481 acctataagg ttggcgcttc agtgtggcct gttgtggcca ctatcaactt ttctgttatc
      541 ccagagaaaa atcgtgtgct attcataagt gtttgtagtt taatatggac ctgctttttg
      601 gcctacatga aacatctgca gcatcatgaa atgaatgaag aggatggatt tatagtaaca
      661 aagaaaacaa aggaaaattc atgattgtcc ccgacgaaaa gatatttttt gttttttttt
      721 t