Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262965 721 bp mRNA linear INV 02-SEP-2023 transcript variant X5, mRNA. ACCESSION XM_013262965 VERSION XM_013262965.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262965.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..721 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..721 /gene="LOC106095674" /note="mpv17-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106095674" CDS 94..684 /gene="LOC106095674" /codon_start=1 /product="uncharacterized protein LOC106095674 isoform X4" /protein_id="XP_013118419.2" /db_xref="GeneID:106095674" /translation="MSTLLQNFKVLITKYPITRGMISYSLIWPVSSLVQQTFEGKTWG NYDWWRCLRFSLYGGLFVAPTLYGWIKVSSAMWPQTSIRTALAKAAVETISYTPGAMT CFYFIMSLLEMKTIEEAASEVRKKFLPTYKVGASVWPVVATINFSVIPEKNRVLFISV CSLIWTCFLAYMKHLQHHEMNEEDGFIVTKKTKENS" polyA_site 721 /gene="LOC106095674" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tctacaaatc acctttgaaa ataaaaacat agtgatcaaa aagtcaaaag tgaacaaaat 61 atcaatcaag caaaaacatc tttgtaagcc gccatgtcta cacttttgca aaatttcaaa 121 gtattaatca ccaaatatcc catcacaaga ggcatgattt catacagtct gatatggccc 181 gtaagtagtc tggtccaaca gacatttgag ggcaaaactt ggggtaatta tgactggtgg 241 cgttgtttac gtttcagttt gtatggaggt ctctttgtcg cccctacgct gtatggttgg 301 attaaggttt cttcagccat gtggcctcag acatcaattc gaacggcttt agctaaggca 361 gctgtcgaga caatatccta tacaccagga gccatgactt gtttctactt catcatgagt 421 ttgttggaga tgaaaaccat agaagaggca gcttctgaag ttcgtaagaa atttctaccc 481 acctataagg ttggcgcttc agtgtggcct gttgtggcca ctatcaactt ttctgttatc 541 ccagagaaaa atcgtgtgct attcataagt gtttgtagtt taatatggac ctgctttttg 601 gcctacatga aacatctgca gcatcatgaa atgaatgaag aggatggatt tatagtaaca 661 aagaaaacaa aggaaaattc atgattgtcc ccgacgaaaa gatatttttt gttttttttt 721 t