Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262955 1501 bp mRNA linear INV 02-SEP-2023 (LOC106095667), transcript variant X6, mRNA. ACCESSION XM_013262955 VERSION XM_013262955.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262955.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1501 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1501 /gene="LOC106095667" /note="ras-related protein Rab-27A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106095667" CDS 518..1222 /gene="LOC106095667" /codon_start=1 /product="ras-related protein Rab-27A" /protein_id="XP_013118409.1" /db_xref="GeneID:106095667" /translation="MSLPNNIDYDYLMKFLALGDSGVGKTSFLYQYTDGRFHSQFIST VGIDFREKRLIYTSRGRNHRIHLQLWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEK SFLEITNWLEQLRQHAYSEDPDVVLCGNKCDLHDFRVVSHQQVTALAERYKLPYIETS ACTGYNVSAAVELLVGRVMERMENAIANAELTRLMSQTHLTNFKNINHHTLRMALLKG EPGSQNEEKCKQNCSC" misc_feature 542..1063 /gene="LOC106095667" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 572..595 /gene="LOC106095667" /note="G1 box; other site" /db_xref="CDD:206700" misc_feature order(578..598,737..739,905..910,914..916,995..1003) /gene="LOC106095667" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206700" misc_feature 647..649 /gene="LOC106095667" /note="G2 box; other site" /db_xref="CDD:206700" misc_feature 659..667 /gene="LOC106095667" /note="Switch I region; other site" /db_xref="CDD:206700" misc_feature 728..739 /gene="LOC106095667" /note="G3 box; other site" /db_xref="CDD:206700" misc_feature order(734..739,785..790) /gene="LOC106095667" /note="Switch II region; other site" /db_xref="CDD:206700" misc_feature 905..916 /gene="LOC106095667" /note="G4 box; other site" /db_xref="CDD:206700" misc_feature 995..1003 /gene="LOC106095667" /note="G5 box; other site" /db_xref="CDD:206700" ORIGIN 1 tcattcgcaa caggtcgctc gttactgttg ctctttgtgt gtgaggtcgc ttgcataaaa 61 attcgaaaga cattacggtc gttttgccta aaagaaagag ccaaacaaaa aaaattgtgt 121 caaagcattt ctttcaagtt tgcagacgta tcaatagatt ttacacacac cattattttc 181 caagtaattg cgggagttct ttttccgagt ttttgtggtg ttcagaagga aacacccccg 241 ttttaagcaa ccatcgccat tatcattcat tcattcaaca tttgggtgta ggaatcgttg 301 cgccaaaagg acaagcaaca gttgttggtg tttttgttaa cggcaagaga gaaaaggaga 361 ccgttaaaaa gtttgtttta catatccatt tgtggttgtc atcggaaacg gaaatcccac 421 agacgaatca ttttgcacag tcacatttgc agctatactc ccagtttccc aagtccttag 481 acctctgcac caacaacaac aacacgagga catcagcatg tcattgccaa acaatattga 541 ttatgactac ctaatgaaat ttctagcatt gggtgattcg ggtgtgggaa agacgagctt 601 tctgtatcag tacacagatg gtcggtttca ttcgcagttc atatcaacag ttggcataga 661 tttccgggag aaacgcttga tttacacatc tcgcggccgt aatcatcgca ttcacctgca 721 actatgggat accgcaggtc aagagagatt tcgctcactc accacagcat tctatcgcga 781 tgccatggga tttctgctca ttttcgatct gaccagcgaa aagtcctttt tggaaatcac 841 caattggcta gaacaattgc gacagcatgc ctactccgag gaccctgatg tggtgttgtg 901 tggcaataaa tgcgacttgc atgactttcg tgtcgtttca catcaacagg tcactgcttt 961 ggcagaacgt tataaactgc catacattga gacaagcgct tgtaccggct acaatgtaag 1021 tgcggccgtt gaacttttgg tgggtcgtgt catggaacgc atggagaatg ccatagccaa 1081 tgctgagcta acacggctaa tgtctcaaac acatttgaca aatttcaaaa atattaatca 1141 tcacaccctg aggatggcgc tgctaaaggg cgaacctgga tcacagaatg aggaaaaatg 1201 taaacaaaac tgtagctgtt gaggccatga gggggcatga aaaaaatatc gcccttgggc 1261 tttgggtatt tggaaattgt tttgtttttt gtatttatgg gacaaccaga acaaaagaac 1321 aaaaaactca attattattc ttcaaaactg ctgttgggta caataaattt tgtgagtgag 1381 ttaccatgag catcaaatgt taaagaaaaa aaatcagttt tatgtttttt gtgcttaaag 1441 taatgttatt atcattatta tgttaagcag ttgtataatg ctcaactttt ttttataact 1501 c