Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ras-related protein Rab-27A


LOCUS       XM_013262955            1501 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095667), transcript variant X6, mRNA.
ACCESSION   XM_013262955
VERSION     XM_013262955.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262955.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1501
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1501
                     /gene="LOC106095667"
                     /note="ras-related protein Rab-27A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106095667"
     CDS             518..1222
                     /gene="LOC106095667"
                     /codon_start=1
                     /product="ras-related protein Rab-27A"
                     /protein_id="XP_013118409.1"
                     /db_xref="GeneID:106095667"
                     /translation="MSLPNNIDYDYLMKFLALGDSGVGKTSFLYQYTDGRFHSQFIST
                     VGIDFREKRLIYTSRGRNHRIHLQLWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEK
                     SFLEITNWLEQLRQHAYSEDPDVVLCGNKCDLHDFRVVSHQQVTALAERYKLPYIETS
                     ACTGYNVSAAVELLVGRVMERMENAIANAELTRLMSQTHLTNFKNINHHTLRMALLKG
                     EPGSQNEEKCKQNCSC"
     misc_feature    542..1063
                     /gene="LOC106095667"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    572..595
                     /gene="LOC106095667"
                     /note="G1 box; other site"
                     /db_xref="CDD:206700"
     misc_feature    order(578..598,737..739,905..910,914..916,995..1003)
                     /gene="LOC106095667"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206700"
     misc_feature    647..649
                     /gene="LOC106095667"
                     /note="G2 box; other site"
                     /db_xref="CDD:206700"
     misc_feature    659..667
                     /gene="LOC106095667"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206700"
     misc_feature    728..739
                     /gene="LOC106095667"
                     /note="G3 box; other site"
                     /db_xref="CDD:206700"
     misc_feature    order(734..739,785..790)
                     /gene="LOC106095667"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206700"
     misc_feature    905..916
                     /gene="LOC106095667"
                     /note="G4 box; other site"
                     /db_xref="CDD:206700"
     misc_feature    995..1003
                     /gene="LOC106095667"
                     /note="G5 box; other site"
                     /db_xref="CDD:206700"
ORIGIN      
        1 tcattcgcaa caggtcgctc gttactgttg ctctttgtgt gtgaggtcgc ttgcataaaa
       61 attcgaaaga cattacggtc gttttgccta aaagaaagag ccaaacaaaa aaaattgtgt
      121 caaagcattt ctttcaagtt tgcagacgta tcaatagatt ttacacacac cattattttc
      181 caagtaattg cgggagttct ttttccgagt ttttgtggtg ttcagaagga aacacccccg
      241 ttttaagcaa ccatcgccat tatcattcat tcattcaaca tttgggtgta ggaatcgttg
      301 cgccaaaagg acaagcaaca gttgttggtg tttttgttaa cggcaagaga gaaaaggaga
      361 ccgttaaaaa gtttgtttta catatccatt tgtggttgtc atcggaaacg gaaatcccac
      421 agacgaatca ttttgcacag tcacatttgc agctatactc ccagtttccc aagtccttag
      481 acctctgcac caacaacaac aacacgagga catcagcatg tcattgccaa acaatattga
      541 ttatgactac ctaatgaaat ttctagcatt gggtgattcg ggtgtgggaa agacgagctt
      601 tctgtatcag tacacagatg gtcggtttca ttcgcagttc atatcaacag ttggcataga
      661 tttccgggag aaacgcttga tttacacatc tcgcggccgt aatcatcgca ttcacctgca
      721 actatgggat accgcaggtc aagagagatt tcgctcactc accacagcat tctatcgcga
      781 tgccatggga tttctgctca ttttcgatct gaccagcgaa aagtcctttt tggaaatcac
      841 caattggcta gaacaattgc gacagcatgc ctactccgag gaccctgatg tggtgttgtg
      901 tggcaataaa tgcgacttgc atgactttcg tgtcgtttca catcaacagg tcactgcttt
      961 ggcagaacgt tataaactgc catacattga gacaagcgct tgtaccggct acaatgtaag
     1021 tgcggccgtt gaacttttgg tgggtcgtgt catggaacgc atggagaatg ccatagccaa
     1081 tgctgagcta acacggctaa tgtctcaaac acatttgaca aatttcaaaa atattaatca
     1141 tcacaccctg aggatggcgc tgctaaaggg cgaacctgga tcacagaatg aggaaaaatg
     1201 taaacaaaac tgtagctgtt gaggccatga gggggcatga aaaaaatatc gcccttgggc
     1261 tttgggtatt tggaaattgt tttgtttttt gtatttatgg gacaaccaga acaaaagaac
     1321 aaaaaactca attattattc ttcaaaactg ctgttgggta caataaattt tgtgagtgag
     1381 ttaccatgag catcaaatgt taaagaaaaa aaatcagttt tatgtttttt gtgcttaaag
     1441 taatgttatt atcattatta tgttaagcag ttgtataatg ctcaactttt ttttataact
     1501 c