Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262947 266 bp mRNA linear INV 02-SEP-2023 complex assembly factor 6 (LOC106095664), mRNA. ACCESSION XM_013262947 VERSION XM_013262947.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262947.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..266 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..266 /gene="LOC106095664" /note="ubiquinol-cytochrome-c reductase complex assembly factor 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106095664" CDS 1..207 /gene="LOC106095664" /codon_start=1 /product="ubiquinol-cytochrome-c reductase complex assembly factor 6" /protein_id="XP_013118401.2" /db_xref="GeneID:106095664" /translation="MPAGVSWGQYLKFMSCAVLSMMAGSQLVHMYYKPLEDLDVYINK EVEDVTKTTGIQLTGITKTSSGNK" ORIGIN 1 atgcctgccg gagtatcatg gggtcaatat ttgaaattta tgtcatgtgc tgtgttatcc 61 atgatggctg gctcacaatt ggtccacatg tactataagc cgctggaaga tttggatgtg 121 tacataaaca aagaagtgga agatgtgacg aaaacaactg gtatacaatt aaccggaatt 181 acgaaaacaa gttctggtaa taaataaaaa taaatgtaca aatttaaaaa ctaaacaaaa 241 agagactttt taaatcgctt catatg