Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ubiquinol-cytochrome-c reductase


LOCUS       XM_013262947             266 bp    mRNA    linear   INV 02-SEP-2023
            complex assembly factor 6 (LOC106095664), mRNA.
ACCESSION   XM_013262947
VERSION     XM_013262947.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262947.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..266
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..266
                     /gene="LOC106095664"
                     /note="ubiquinol-cytochrome-c reductase complex assembly
                     factor 6; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:106095664"
     CDS             1..207
                     /gene="LOC106095664"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase complex
                     assembly factor 6"
                     /protein_id="XP_013118401.2"
                     /db_xref="GeneID:106095664"
                     /translation="MPAGVSWGQYLKFMSCAVLSMMAGSQLVHMYYKPLEDLDVYINK
                     EVEDVTKTTGIQLTGITKTSSGNK"
ORIGIN      
        1 atgcctgccg gagtatcatg gggtcaatat ttgaaattta tgtcatgtgc tgtgttatcc
       61 atgatggctg gctcacaatt ggtccacatg tactataagc cgctggaaga tttggatgtg
      121 tacataaaca aagaagtgga agatgtgacg aaaacaactg gtatacaatt aaccggaatt
      181 acgaaaacaa gttctggtaa taaataaaaa taaatgtaca aatttaaaaa ctaaacaaaa
      241 agagactttt taaatcgctt catatg