Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262946 356 bp mRNA linear INV 02-SEP-2023 (LOC106095662), mRNA. ACCESSION XM_013262946 VERSION XM_013262946.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262946.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..356 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..356 /gene="LOC106095662" /note="small integral membrane protein 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106095662" CDS 99..356 /gene="LOC106095662" /codon_start=1 /product="small integral membrane protein 4" /protein_id="XP_013118400.1" /db_xref="GeneID:106095662" /translation="MKVYSSTFKRILDSVPGKKRFGVYRFLPVFFCLGAALEFSMINW TVGETNFYRTFKKRQAKNYVEEKIHHLGTETTANTTASQAS" misc_feature 108..305 /gene="LOC106095662" /note="Uncharacterized protein family UPF0640; Region: UPF0640; pfam15114" /db_xref="CDD:464511" ORIGIN 1 ataacttttt cccaaagtcg aacaacatgc aatggaaatt tacgaaaata ttgaataaat 61 aacagaatag tgcaataaac tcaaaatatt ccagagatat gaaagtctat agttcaacct 121 ttaaacgtat tctggatagt gtgcctggaa aaaaacgttt tggtgtctat cgttttctac 181 cggttttctt ctgtttgggt gctgcccttg agttctctat gataaattgg acagttggag 241 aaacaaattt ttatagaaca tttaagaaac gacaagcaaa gaactacgta gaagagaaaa 301 tacatcatct aggaacagag actactgcaa ataccacagc atcccaagct tcataa