Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans small integral membrane protein 4


LOCUS       XM_013262946             356 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095662), mRNA.
ACCESSION   XM_013262946
VERSION     XM_013262946.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262946.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..356
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..356
                     /gene="LOC106095662"
                     /note="small integral membrane protein 4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106095662"
     CDS             99..356
                     /gene="LOC106095662"
                     /codon_start=1
                     /product="small integral membrane protein 4"
                     /protein_id="XP_013118400.1"
                     /db_xref="GeneID:106095662"
                     /translation="MKVYSSTFKRILDSVPGKKRFGVYRFLPVFFCLGAALEFSMINW
                     TVGETNFYRTFKKRQAKNYVEEKIHHLGTETTANTTASQAS"
     misc_feature    108..305
                     /gene="LOC106095662"
                     /note="Uncharacterized protein family UPF0640; Region:
                     UPF0640; pfam15114"
                     /db_xref="CDD:464511"
ORIGIN      
        1 ataacttttt cccaaagtcg aacaacatgc aatggaaatt tacgaaaata ttgaataaat
       61 aacagaatag tgcaataaac tcaaaatatt ccagagatat gaaagtctat agttcaacct
      121 ttaaacgtat tctggatagt gtgcctggaa aaaaacgttt tggtgtctat cgttttctac
      181 cggttttctt ctgtttgggt gctgcccttg agttctctat gataaattgg acagttggag
      241 aaacaaattt ttatagaaca tttaagaaac gacaagcaaa gaactacgta gaagagaaaa
      301 tacatcatct aggaacagag actactgcaa ataccacagc atcccaagct tcataa