Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262945 693 bp mRNA linear INV 02-SEP-2023 (LOC106095661), mRNA. ACCESSION XM_013262945 VERSION XM_013262945.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262945.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..693 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..693 /gene="LOC106095661" /note="uncharacterized LOC106095661; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106095661" CDS 97..669 /gene="LOC106095661" /codon_start=1 /product="uncharacterized protein LOC106095661" /protein_id="XP_013118399.2" /db_xref="GeneID:106095661" /translation="MWKIFKLLLLQFAWQCLQAADYAIIGDDQTFFQACDAHDDGGTT NLKELVEFNMINEYADDMETIITNGNVTILVDIDPQVPISLEVEIYKWERGTWVDSIF SIRRSNFCATAFSPKEFWYPFIKQFPEENRVCPPKKGHVYQFKDIKNRMDFFNVSMSH DYSGKYKAIIYFIVDQYSLCLSSVVDVWSS" ORIGIN 1 aatttctatt gttaagattt attataaaat agccagttta gcagctagcg ctagtagtga 61 gttgaggatt tctctaaaaa attaaaacaa ttttaaatgt ggaaaatatt caaattatta 121 ttacttcagt ttgcttggca gtgccttcag gcagcagact atgccataat tggtgacgat 181 cagaccttct ttcaagcctg cgatgctcat gatgatggtg gtacaacaaa tttaaaggag 241 ctggtcgagt ttaatatgat caatgagtat gcggatgaca tggagacgat tataaccaat 301 ggcaatgtaa ccatcttagt tgatattgat cctcaggttc ctatatccct agaagtcgag 361 atatataaat gggagcgtgg tacttgggta gattcaattt tttcaattag acgttcaaat 421 ttttgtgcca ccgcctttag tcccaaagaa ttctggtatc cttttatcaa gcaatttcct 481 gaagagaatc gtgtctgtcc cccaaaaaaa ggacatgttt atcaattcaa agatatcaaa 541 aatcgcatgg attttttcaa cgtttctatg agccatgact attcgggcaa atataaggct 601 ataatttatt ttatagtcga ccaatattcc ttgtgccttt cgtcggttgt cgatgtatgg 661 agctcttgaa caacatgtga atgatgagga ata