Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095661


LOCUS       XM_013262945             693 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095661), mRNA.
ACCESSION   XM_013262945
VERSION     XM_013262945.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262945.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..693
                     /gene="LOC106095661"
                     /note="uncharacterized LOC106095661; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106095661"
     CDS             97..669
                     /gene="LOC106095661"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095661"
                     /protein_id="XP_013118399.2"
                     /db_xref="GeneID:106095661"
                     /translation="MWKIFKLLLLQFAWQCLQAADYAIIGDDQTFFQACDAHDDGGTT
                     NLKELVEFNMINEYADDMETIITNGNVTILVDIDPQVPISLEVEIYKWERGTWVDSIF
                     SIRRSNFCATAFSPKEFWYPFIKQFPEENRVCPPKKGHVYQFKDIKNRMDFFNVSMSH
                     DYSGKYKAIIYFIVDQYSLCLSSVVDVWSS"
ORIGIN      
        1 aatttctatt gttaagattt attataaaat agccagttta gcagctagcg ctagtagtga
       61 gttgaggatt tctctaaaaa attaaaacaa ttttaaatgt ggaaaatatt caaattatta
      121 ttacttcagt ttgcttggca gtgccttcag gcagcagact atgccataat tggtgacgat
      181 cagaccttct ttcaagcctg cgatgctcat gatgatggtg gtacaacaaa tttaaaggag
      241 ctggtcgagt ttaatatgat caatgagtat gcggatgaca tggagacgat tataaccaat
      301 ggcaatgtaa ccatcttagt tgatattgat cctcaggttc ctatatccct agaagtcgag
      361 atatataaat gggagcgtgg tacttgggta gattcaattt tttcaattag acgttcaaat
      421 ttttgtgcca ccgcctttag tcccaaagaa ttctggtatc cttttatcaa gcaatttcct
      481 gaagagaatc gtgtctgtcc cccaaaaaaa ggacatgttt atcaattcaa agatatcaaa
      541 aatcgcatgg attttttcaa cgtttctatg agccatgact attcgggcaa atataaggct
      601 ataatttatt ttatagtcga ccaatattcc ttgtgccttt cgtcggttgt cgatgtatgg
      661 agctcttgaa caacatgtga atgatgagga ata