Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein CutA homolog (LOC106095660),


LOCUS       XM_013262944             785 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013262944
VERSION     XM_013262944.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262944.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..785
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..785
                     /gene="LOC106095660"
                     /note="protein CutA homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106095660"
     CDS             16..612
                     /gene="LOC106095660"
                     /codon_start=1
                     /product="protein CutA homolog"
                     /protein_id="XP_013118398.1"
                     /db_xref="GeneID:106095660"
                     /translation="MSKDFVARSLILSQYRHRKTILMHFLRKLFYTTSYLLLADNLTS
                     LAAKHISVSTVLSTFGVTAAAFCTKVSNADNISANSIMDSGEFKYESGKSSVAFVTAP
                     DEKIAKKLAHGLVEQKLAACINIIPNIQSIYMWEGKVNEDNEYLMMIKTQTTHVEELT
                     KWVRDNHPYSVAEVITLPIEKGNLPYMKWLAESVPEKK"
     misc_feature    301..594
                     /gene="LOC106095660"
                     /note="CutA1 divalent ion tolerance protein; Region:
                     CutA1; pfam03091"
                     /db_xref="CDD:460800"
     polyA_site      785
                     /gene="LOC106095660"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagaaataaa aacatatgtc aaaagatttt gttgctaggt ccttaatttt atctcaatac
       61 cggcatcgga agacaatttt gatgcatttt ttacgaaaat tattttatac cacgtcgtat
      121 ctactgttgg ctgacaattt gacttctctt gctgcaaaac atattagtgt cagtactgtg
      181 ctctcaactt ttggtgtaac tgcagcagcc ttctgtacca aagtttcaaa cgccgataac
      241 atttcagcaa atagtatcat ggatagtgga gaatttaagt atgaatcggg caaaagttct
      301 gtagcttttg taactgcacc agatgagaaa attgccaaga aactagccca cggtttggtg
      361 gagcaaaaat tagcagcatg tatcaacatc atacccaaca tacaatccat ttatatgtgg
      421 gagggcaagg taaacgagga caatgaatat ctgatgatga taaagactca aacaacacat
      481 gtggaggaac taacgaaatg ggttcgcgac aatcatccct acagtgtggc agaggtcata
      541 acattaccca tagagaaagg aaatttgcca tatatgaaat ggttggcaga atctgtgcca
      601 gagaagaagt aaataaagtt catacacaat gagatttagg ttatagtttt gtacattcaa
      661 caacctttct tcatgatcga atattgtaaa taaaaaataa taaacatttg taaactcaga
      721 acctttacat aaatacgcaa gcaaattttg taataataaa agataaagaa actcttggaa
      781 ccgaa