Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262944 785 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013262944 VERSION XM_013262944.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262944.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..785 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..785 /gene="LOC106095660" /note="protein CutA homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106095660" CDS 16..612 /gene="LOC106095660" /codon_start=1 /product="protein CutA homolog" /protein_id="XP_013118398.1" /db_xref="GeneID:106095660" /translation="MSKDFVARSLILSQYRHRKTILMHFLRKLFYTTSYLLLADNLTS LAAKHISVSTVLSTFGVTAAAFCTKVSNADNISANSIMDSGEFKYESGKSSVAFVTAP DEKIAKKLAHGLVEQKLAACINIIPNIQSIYMWEGKVNEDNEYLMMIKTQTTHVEELT KWVRDNHPYSVAEVITLPIEKGNLPYMKWLAESVPEKK" misc_feature 301..594 /gene="LOC106095660" /note="CutA1 divalent ion tolerance protein; Region: CutA1; pfam03091" /db_xref="CDD:460800" polyA_site 785 /gene="LOC106095660" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagaaataaa aacatatgtc aaaagatttt gttgctaggt ccttaatttt atctcaatac 61 cggcatcgga agacaatttt gatgcatttt ttacgaaaat tattttatac cacgtcgtat 121 ctactgttgg ctgacaattt gacttctctt gctgcaaaac atattagtgt cagtactgtg 181 ctctcaactt ttggtgtaac tgcagcagcc ttctgtacca aagtttcaaa cgccgataac 241 atttcagcaa atagtatcat ggatagtgga gaatttaagt atgaatcggg caaaagttct 301 gtagcttttg taactgcacc agatgagaaa attgccaaga aactagccca cggtttggtg 361 gagcaaaaat tagcagcatg tatcaacatc atacccaaca tacaatccat ttatatgtgg 421 gagggcaagg taaacgagga caatgaatat ctgatgatga taaagactca aacaacacat 481 gtggaggaac taacgaaatg ggttcgcgac aatcatccct acagtgtggc agaggtcata 541 acattaccca tagagaaagg aaatttgcca tatatgaaat ggttggcaga atctgtgcca 601 gagaagaagt aaataaagtt catacacaat gagatttagg ttatagtttt gtacattcaa 661 caacctttct tcatgatcga atattgtaaa taaaaaataa taaacatttg taaactcaga 721 acctttacat aaatacgcaa gcaaattttg taataataaa agataaagaa actcttggaa 781 ccgaa