Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095650


LOCUS       XM_013262932             768 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095650), mRNA.
ACCESSION   XM_013262932
VERSION     XM_013262932.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262932.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..768
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..768
                     /gene="LOC106095650"
                     /note="uncharacterized LOC106095650; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106095650"
     CDS             111..710
                     /gene="LOC106095650"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095650"
                     /protein_id="XP_013118386.2"
                     /db_xref="GeneID:106095650"
                     /translation="MGARNSTPQTANIDNPKRVVPIEITAEVMTRLEAKTKQQEKPIE
                     LNEFEDHKKELEFGKTQRPKVQRETSNDFRPTGKYPHEHSHWFEEQTADRRSNYNEHE
                     EYQFERTLSMLENVLGKPVDIMSDNKQEIQALRRDLIECYKEYPGKTLYCADIAKRYQ
                     DFIFRQQYERILEHVESNEDFAEQAKQPPPPFEHFPPYF"
     polyA_site      768
                     /gene="LOC106095650"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actttactct ttcatcttat aactttaaaa atattaacat taatataatt tggtttttat
       61 gtcataataa aatacataat tcattcaaaa agagaaaagc aaactacaaa atgggagcca
      121 gaaactcaac tccgcaaact gccaacattg acaatcccaa aagggttgtg cccattgaaa
      181 tcacggctga agtaatgacc agattggaag cgaaaacaaa gcaacaggaa aaacccatag
      241 agctcaatga atttgaagac cacaaaaagg aactagaatt tggaaaaaca cagcgtccaa
      301 aggtacaaag agaaacttca aatgattttc gtcctacagg aaaatatcca catgagcaca
      361 gccattggtt cgaggaacaa acggcagacc gtcgtagcaa ctataatgag catgaggaat
      421 atcaatttga aaggaccctt agcatgttag aaaatgtcct tggcaaacct gtagacatta
      481 tgtccgataa taagcaagaa attcaagctc tgcgccggga tttaattgaa tgctataaag
      541 aatatccggg aaaaacctta tattgtgctg atatagctaa acgttatcag gatttcatat
      601 tccgtcaaca gtatgaaaga attttagaac atgtggaatc gaatgaagat tttgcggaac
      661 aggcaaaaca gcctccacca ccttttgaac attttccacc atatttctaa tcaatgttaa
      721 ttttatttga gtttgttgaa taaatttcaa aaaatgttaa cttcacaa