Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262932 768 bp mRNA linear INV 02-SEP-2023 (LOC106095650), mRNA. ACCESSION XM_013262932 VERSION XM_013262932.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262932.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..768 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..768 /gene="LOC106095650" /note="uncharacterized LOC106095650; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095650" CDS 111..710 /gene="LOC106095650" /codon_start=1 /product="uncharacterized protein LOC106095650" /protein_id="XP_013118386.2" /db_xref="GeneID:106095650" /translation="MGARNSTPQTANIDNPKRVVPIEITAEVMTRLEAKTKQQEKPIE LNEFEDHKKELEFGKTQRPKVQRETSNDFRPTGKYPHEHSHWFEEQTADRRSNYNEHE EYQFERTLSMLENVLGKPVDIMSDNKQEIQALRRDLIECYKEYPGKTLYCADIAKRYQ DFIFRQQYERILEHVESNEDFAEQAKQPPPPFEHFPPYF" polyA_site 768 /gene="LOC106095650" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actttactct ttcatcttat aactttaaaa atattaacat taatataatt tggtttttat 61 gtcataataa aatacataat tcattcaaaa agagaaaagc aaactacaaa atgggagcca 121 gaaactcaac tccgcaaact gccaacattg acaatcccaa aagggttgtg cccattgaaa 181 tcacggctga agtaatgacc agattggaag cgaaaacaaa gcaacaggaa aaacccatag 241 agctcaatga atttgaagac cacaaaaagg aactagaatt tggaaaaaca cagcgtccaa 301 aggtacaaag agaaacttca aatgattttc gtcctacagg aaaatatcca catgagcaca 361 gccattggtt cgaggaacaa acggcagacc gtcgtagcaa ctataatgag catgaggaat 421 atcaatttga aaggaccctt agcatgttag aaaatgtcct tggcaaacct gtagacatta 481 tgtccgataa taagcaagaa attcaagctc tgcgccggga tttaattgaa tgctataaag 541 aatatccggg aaaaacctta tattgtgctg atatagctaa acgttatcag gatttcatat 601 tccgtcaaca gtatgaaaga attttagaac atgtggaatc gaatgaagat tttgcggaac 661 aggcaaaaca gcctccacca ccttttgaac attttccacc atatttctaa tcaatgttaa 721 ttttatttga gtttgttgaa taaatttcaa aaaatgttaa cttcacaa