PREDICTED: Stomoxys calcitrans trypsin beta (LOC106095505), mRNA.

LOCUS       XM_013262740             825 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013262740
VERSION     XM_013262740.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262740.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..825
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..825
                     /gene="LOC106095505"
                     /note="trypsin beta; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 26 Proteins"
                     /db_xref="GeneID:106095505"
     CDS             1..825
                     /gene="LOC106095505"
                     /codon_start=1
                     /product="trypsin beta"
                     /protein_id="XP_013118194.2"
                     /db_xref="GeneID:106095505"
                     /translation="MLKAFVLLIGSICLSVGATSTGIPDGSVPFVPKCLNGGRYAAIE
                     DFPFEVSIQLIDLAATNRGTHIGSGVIYNKYVILTAASVVVGRAASNLQIRAGSTCHK
                     TGGQLIKVAVIKIHDCFDAVTLRHDIALLKLKSPLVLDGHRVSRAHIGKFEPSNNETG
                     RVVGYGSSMDGLALYNTDLRQATIRYLNLKACTSSFYGYTNDGLKIGVFCGRARNQDS
                     CQMDRGSPAMFQGSLVGLFSWARGCAEEIYPGIYTSVIEYHKYIICASHNLLTTPK"
ORIGIN      
        1 atgctaaaag cttttgtgtt actaatcggc agcatttgtc tgtctgtggg tgcaacatca
       61 acaggcattc cggatggttc agtgcctttt gtaccaaaat gtctaaatgg aggccgttat
      121 gctgccatag aggactttcc ctttgaggtt tccatacagt tgattgattt ggcagcaacc
      181 aataggggaa cccacattgg ctccggcgtc atttacaaca aatatgtaat tttgactgcg
      241 gccagtgtgg tcgtgggcag agcagcttca aatcttcaaa tacgtgccgg ctcaacttgc
      301 cacaagaccg gaggtcagct gataaaagtg gctgtgataa aaattcacga ttgcttcgat
      361 gcagtaactc tgcgccatga tattgccctg ttaaagctca aatcaccgct ggttctcgat
      421 ggccacagag tcagccgagc ccatataggc aaatttgagc caagcaataa tgaaactgga
      481 agggtggtgg gatacggctc ctcaatggat ggcctagcac tctacaacac tgacttgaga
      541 caggcgacca ttaggtatct caatcttaaa gcgtgcacaa gcagctttta tggttacacc
      601 aacgatggac tgaaaattgg tgtattctgt ggtagagctc gcaaccagga ctcatgtcaa
      661 atggataggg gaagtccggc aatgtttcag ggcagcttgg ttggtctctt ttcttgggct
      721 cgtggctgtg ctgaggaaat atatccagga atatacacga gtgtgataga atatcataaa
      781 tatattatat gtgcttcaca taatctgtta acaacgccaa agtaa