Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable RNA-binding protein 18


LOCUS       XM_013262618             750 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095383), transcript variant X3, mRNA.
ACCESSION   XM_013262618
VERSION     XM_013262618.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262618.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..750
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..750
                     /gene="LOC106095383"
                     /note="probable RNA-binding protein 18; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106095383"
     CDS             102..566
                     /gene="LOC106095383"
                     /codon_start=1
                     /product="probable RNA-binding protein 18 isoform X2"
                     /protein_id="XP_013118072.1"
                     /db_xref="GeneID:106095383"
                     /translation="MLFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPI
                     AVRMAKNINYDEFERPKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDID
                     FDQPAAGPVIPLIQKYQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR"
     misc_feature    <102..251
                     /gene="LOC106095383"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:473069"
     polyA_site      750
                     /gene="LOC106095383"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcttctacaa gttctgctgg ccatgctgat gatagacgta tttgggtggg taatttggat
       61 cccagactaa acgaaaatgt ggcgagattg aaaaattcga tatgctattc cacaaaggtg
      121 gtcccctgca gggccaatcc cgtggttatg ctttcgttac ctttgtcaag gccagtgcag
      181 ctgtgatagc cttggaaaaa ctaaatggcc acatgatatt gaatcggccc attgcagtga
      241 gaatggcaaa aaatatcaat tatgatgaat ttgagcgccc caaaccaaag atcgaaattc
      301 ctgctctggg cactggtaaa cgtgagggga aaattactcg agaagaggcc attaaagcca
      361 ttgaacaaaa actaaaaatc attgaatctc aaggtgatga tatcgatttc gatcaacctg
      421 ctgcgggacc tgtaatacct ttaatacaaa aatatcaatt caacaaggat cgagatgcca
      481 aaacagctac aacggcaaca caacgtcgtc cgtatcataa aaccagtggc ccctataaca
      541 ggcaccaaag accgaaaaga agataaaacg ccatactcac gatgatgcgg agtacttata
      601 agtttcaaac cattttcaca actttttgac catcccctgt gttatgttta taagcctcac
      661 aacaaacaac taccttaaca aatctcccta ttgctagagg gactaataaa aacttaattg
      721 tattttagca aaatttaata gcaacaacaa