Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262618 750 bp mRNA linear INV 02-SEP-2023 (LOC106095383), transcript variant X3, mRNA. ACCESSION XM_013262618 VERSION XM_013262618.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262618.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..750 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..750 /gene="LOC106095383" /note="probable RNA-binding protein 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095383" CDS 102..566 /gene="LOC106095383" /codon_start=1 /product="probable RNA-binding protein 18 isoform X2" /protein_id="XP_013118072.1" /db_xref="GeneID:106095383" /translation="MLFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPI AVRMAKNINYDEFERPKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDID FDQPAAGPVIPLIQKYQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR" misc_feature <102..251 /gene="LOC106095383" /note="RNA recognition motif (RRM) superfamily; Region: RRM_SF; cl17169" /db_xref="CDD:473069" polyA_site 750 /gene="LOC106095383" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcttctacaa gttctgctgg ccatgctgat gatagacgta tttgggtggg taatttggat 61 cccagactaa acgaaaatgt ggcgagattg aaaaattcga tatgctattc cacaaaggtg 121 gtcccctgca gggccaatcc cgtggttatg ctttcgttac ctttgtcaag gccagtgcag 181 ctgtgatagc cttggaaaaa ctaaatggcc acatgatatt gaatcggccc attgcagtga 241 gaatggcaaa aaatatcaat tatgatgaat ttgagcgccc caaaccaaag atcgaaattc 301 ctgctctggg cactggtaaa cgtgagggga aaattactcg agaagaggcc attaaagcca 361 ttgaacaaaa actaaaaatc attgaatctc aaggtgatga tatcgatttc gatcaacctg 421 ctgcgggacc tgtaatacct ttaatacaaa aatatcaatt caacaaggat cgagatgcca 481 aaacagctac aacggcaaca caacgtcgtc cgtatcataa aaccagtggc ccctataaca 541 ggcaccaaag accgaaaaga agataaaacg ccatactcac gatgatgcgg agtacttata 601 agtttcaaac cattttcaca actttttgac catcccctgt gttatgttta taagcctcac 661 aacaaacaac taccttaaca aatctcccta ttgctagagg gactaataaa aacttaattg 721 tattttagca aaatttaata gcaacaacaa