Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable RNA-binding protein 18


LOCUS       XM_013262617             776 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095383), transcript variant X2, mRNA.
ACCESSION   XM_013262617
VERSION     XM_013262617.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262617.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..776
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..776
                     /gene="LOC106095383"
                     /note="probable RNA-binding protein 18; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106095383"
     CDS             128..592
                     /gene="LOC106095383"
                     /codon_start=1
                     /product="probable RNA-binding protein 18 isoform X2"
                     /protein_id="XP_013118071.1"
                     /db_xref="GeneID:106095383"
                     /translation="MLFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPI
                     AVRMAKNINYDEFERPKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDID
                     FDQPAAGPVIPLIQKYQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR"
     misc_feature    <128..277
                     /gene="LOC106095383"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:473069"
     polyA_site      776
                     /gene="LOC106095383"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cactatttac acaaaatggc ttctacaagt tctgctggcc atgctgatga tagacgtatt
       61 tgggtgggta atttggatcc cagactaaac gattgtgcag aaatgtggcg agattgaaaa
      121 attcgatatg ctattccaca aaggtggtcc cctgcagggc caatcccgtg gttatgcttt
      181 cgttaccttt gtcaaggcca gtgcagctgt gatagccttg gaaaaactaa atggccacat
      241 gatattgaat cggcccattg cagtgagaat ggcaaaaaat atcaattatg atgaatttga
      301 gcgccccaaa ccaaagatcg aaattcctgc tctgggcact ggtaaacgtg aggggaaaat
      361 tactcgagaa gaggccatta aagccattga acaaaaacta aaaatcattg aatctcaagg
      421 tgatgatatc gatttcgatc aacctgctgc gggacctgta atacctttaa tacaaaaata
      481 tcaattcaac aaggatcgag atgccaaaac agctacaacg gcaacacaac gtcgtccgta
      541 tcataaaacc agtggcccct ataacaggca ccaaagaccg aaaagaagat aaaacgccat
      601 actcacgatg atgcggagta cttataagtt tcaaaccatt ttcacaactt tttgaccatc
      661 ccctgtgtta tgtttataag cctcacaaca aacaactacc ttaacaaatc tccctattgc
      721 tagagggact aataaaaact taattgtatt ttagcaaaat ttaatagcaa caacaa