Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262617 776 bp mRNA linear INV 02-SEP-2023 (LOC106095383), transcript variant X2, mRNA. ACCESSION XM_013262617 VERSION XM_013262617.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262617.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..776 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..776 /gene="LOC106095383" /note="probable RNA-binding protein 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095383" CDS 128..592 /gene="LOC106095383" /codon_start=1 /product="probable RNA-binding protein 18 isoform X2" /protein_id="XP_013118071.1" /db_xref="GeneID:106095383" /translation="MLFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPI AVRMAKNINYDEFERPKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDID FDQPAAGPVIPLIQKYQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR" misc_feature <128..277 /gene="LOC106095383" /note="RNA recognition motif (RRM) superfamily; Region: RRM_SF; cl17169" /db_xref="CDD:473069" polyA_site 776 /gene="LOC106095383" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cactatttac acaaaatggc ttctacaagt tctgctggcc atgctgatga tagacgtatt 61 tgggtgggta atttggatcc cagactaaac gattgtgcag aaatgtggcg agattgaaaa 121 attcgatatg ctattccaca aaggtggtcc cctgcagggc caatcccgtg gttatgcttt 181 cgttaccttt gtcaaggcca gtgcagctgt gatagccttg gaaaaactaa atggccacat 241 gatattgaat cggcccattg cagtgagaat ggcaaaaaat atcaattatg atgaatttga 301 gcgccccaaa ccaaagatcg aaattcctgc tctgggcact ggtaaacgtg aggggaaaat 361 tactcgagaa gaggccatta aagccattga acaaaaacta aaaatcattg aatctcaagg 421 tgatgatatc gatttcgatc aacctgctgc gggacctgta atacctttaa tacaaaaata 481 tcaattcaac aaggatcgag atgccaaaac agctacaacg gcaacacaac gtcgtccgta 541 tcataaaacc agtggcccct ataacaggca ccaaagaccg aaaagaagat aaaacgccat 601 actcacgatg atgcggagta cttataagtt tcaaaccatt ttcacaactt tttgaccatc 661 ccctgtgtta tgtttataag cctcacaaca aacaactacc ttaacaaatc tccctattgc 721 tagagggact aataaaaact taattgtatt ttagcaaaat ttaatagcaa caacaa