Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262616 859 bp mRNA linear INV 02-SEP-2023 (LOC106095383), transcript variant X1, mRNA. ACCESSION XM_013262616 VERSION XM_013262616.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262616.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..859 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..859 /gene="LOC106095383" /note="probable RNA-binding protein 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106095383" CDS 82..675 /gene="LOC106095383" /codon_start=1 /product="probable RNA-binding protein 18 isoform X1" /protein_id="XP_013118070.1" /db_xref="GeneID:106095383" /translation="MASTSSAGHADDRRIWVGNLDPRLNEYHLLKVVQKCGEIEKFDM LFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPIAVRMAKNINYDEFER PKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDIDFDQPAAGPVIPLIQK YQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR" misc_feature 121..360 /gene="LOC106095383" /note="RNA recognition motif (RRM) found in eukaryotic RNA-binding protein 18 and similar proteins; Region: RRM_RBM18; cd12355" /db_xref="CDD:409791" polyA_site 859 /gene="LOC106095383" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aacattgacg gcgttggtac tctaccaccc gttctcctgc ttccataaat ttcttagtat 61 atcgtacact atttacacaa aatggcttct acaagttctg ctggccatgc tgatgataga 121 cgtatttggg tgggtaattt ggatcccaga ctaaacgagt atcacctcct gaaagttgtg 181 cagaaatgtg gcgagattga aaaattcgat atgctattcc acaaaggtgg tcccctgcag 241 ggccaatccc gtggttatgc tttcgttacc tttgtcaagg ccagtgcagc tgtgatagcc 301 ttggaaaaac taaatggcca catgatattg aatcggccca ttgcagtgag aatggcaaaa 361 aatatcaatt atgatgaatt tgagcgcccc aaaccaaaga tcgaaattcc tgctctgggc 421 actggtaaac gtgaggggaa aattactcga gaagaggcca ttaaagccat tgaacaaaaa 481 ctaaaaatca ttgaatctca aggtgatgat atcgatttcg atcaacctgc tgcgggacct 541 gtaatacctt taatacaaaa atatcaattc aacaaggatc gagatgccaa aacagctaca 601 acggcaacac aacgtcgtcc gtatcataaa accagtggcc cctataacag gcaccaaaga 661 ccgaaaagaa gataaaacgc catactcacg atgatgcgga gtacttataa gtttcaaacc 721 attttcacaa ctttttgacc atcccctgtg ttatgtttat aagcctcaca acaaacaact 781 accttaacaa atctccctat tgctagaggg actaataaaa acttaattgt attttagcaa 841 aatttaatag caacaacaa