Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable RNA-binding protein 18


LOCUS       XM_013262616             859 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095383), transcript variant X1, mRNA.
ACCESSION   XM_013262616
VERSION     XM_013262616.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262616.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..859
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..859
                     /gene="LOC106095383"
                     /note="probable RNA-binding protein 18; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106095383"
     CDS             82..675
                     /gene="LOC106095383"
                     /codon_start=1
                     /product="probable RNA-binding protein 18 isoform X1"
                     /protein_id="XP_013118070.1"
                     /db_xref="GeneID:106095383"
                     /translation="MASTSSAGHADDRRIWVGNLDPRLNEYHLLKVVQKCGEIEKFDM
                     LFHKGGPLQGQSRGYAFVTFVKASAAVIALEKLNGHMILNRPIAVRMAKNINYDEFER
                     PKPKIEIPALGTGKREGKITREEAIKAIEQKLKIIESQGDDIDFDQPAAGPVIPLIQK
                     YQFNKDRDAKTATTATQRRPYHKTSGPYNRHQRPKRR"
     misc_feature    121..360
                     /gene="LOC106095383"
                     /note="RNA recognition motif (RRM) found in eukaryotic
                     RNA-binding protein 18 and similar proteins; Region:
                     RRM_RBM18; cd12355"
                     /db_xref="CDD:409791"
     polyA_site      859
                     /gene="LOC106095383"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacattgacg gcgttggtac tctaccaccc gttctcctgc ttccataaat ttcttagtat
       61 atcgtacact atttacacaa aatggcttct acaagttctg ctggccatgc tgatgataga
      121 cgtatttggg tgggtaattt ggatcccaga ctaaacgagt atcacctcct gaaagttgtg
      181 cagaaatgtg gcgagattga aaaattcgat atgctattcc acaaaggtgg tcccctgcag
      241 ggccaatccc gtggttatgc tttcgttacc tttgtcaagg ccagtgcagc tgtgatagcc
      301 ttggaaaaac taaatggcca catgatattg aatcggccca ttgcagtgag aatggcaaaa
      361 aatatcaatt atgatgaatt tgagcgcccc aaaccaaaga tcgaaattcc tgctctgggc
      421 actggtaaac gtgaggggaa aattactcga gaagaggcca ttaaagccat tgaacaaaaa
      481 ctaaaaatca ttgaatctca aggtgatgat atcgatttcg atcaacctgc tgcgggacct
      541 gtaatacctt taatacaaaa atatcaattc aacaaggatc gagatgccaa aacagctaca
      601 acggcaacac aacgtcgtcc gtatcataaa accagtggcc cctataacag gcaccaaaga
      661 ccgaaaagaa gataaaacgc catactcacg atgatgcgga gtacttataa gtttcaaacc
      721 attttcacaa ctttttgacc atcccctgtg ttatgtttat aagcctcaca acaaacaact
      781 accttaacaa atctccctat tgctagaggg actaataaaa acttaattgt attttagcaa
      841 aatttaatag caacaacaa