Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262581 1370 bp mRNA linear INV 02-SEP-2023 homolog (LOC106095345), transcript variant X1, mRNA. ACCESSION XM_013262581 VERSION XM_013262581.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262581.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1370 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1370 /gene="LOC106095345" /note="CTD nuclear envelope phosphatase 1 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:106095345" CDS 459..1190 /gene="LOC106095345" /codon_start=1 /product="CTD nuclear envelope phosphatase 1 homolog isoform X1" /protein_id="XP_013118035.1" /db_xref="GeneID:106095345" /translation="MFSLVQMKFRALLVLLSKIWTCICFMFNRQVRAFVQYQPVKYEL FPLSPVSRHRLSIVQRKTLVLDLDETLIHSHHNAMPRNIVKPGTPHDFTVKVTIDRHP VRFFVHKRPHVDFFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHC TPDYGSYTKDLSAICNDLNRIFIIDNSPAAYRCFPHNAIPIKSWFSDPMDISLLSLLP MLDALRFTNDVRSVLSRNLHLHGLW" misc_feature 636..1142 /gene="LOC106095345" /note="Dullard-like phosphatase domain; Region: HIF-SF_euk; TIGR02251" /db_xref="CDD:274055" misc_feature order(654..668,678..683,843..854,864..866,963..965, 1011..1016,1020..1028) /gene="LOC106095345" /note="active site" /db_xref="CDD:319823" polyA_site 1370 /gene="LOC106095345" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agacggcaac tctgatggta actgcgaaag cggcaatcaa cgaaccaaca caccaaaaat 61 ataaattcag ttttgtcgtg tagtgtgaga ttgttgtgta cttttatagt gatacgtgaa 121 aaatgttaaa tcttatattt caataaaaat ggatgcagaa atgaacacgc tgatcaaata 181 cccttataat ggaatccaat gtagcagaaa tccaacaatt aagtgccgtc gcgtgtaaac 241 aacaacaaca aaaatagcaa acaatcatca ggcatttgaa acaagcaata agcacccgcc 301 tcctcttagg tgaaagatag attggtcatt tgttttaaac agatactata ttttgagaat 361 aggttttggt taaaaaaaaa gtatatacat acatatatat acatagaaat atacataaac 421 atttatgtag tgttcattgg taagtttctt tcttaccaat gttttccctc gttcaaatga 481 aattccgtgc tttactggta ctactatcaa aaatatggac gtgcatatgt tttatgttca 541 atcgtcaagt aagagcattt gtccagtatc aacctgtcaa atatgaacta tttccactgt 601 cccctgtgtc gcgacaccgc ctcagcattg tacaacggaa gactttggtt ttggatttgg 661 atgaaacatt aatacattcg catcacaatg ctatgcccag gaatattgtt aaacccggaa 721 cacctcatga ttttacagtc aaagtaacaa tagatagaca tccggtgaga ttttttgtac 781 ataaaagacc acatgtcgat ttcttcctag acgtggtttc gcaatggtat gacttggtgg 841 ttttcacagc cagtatggag atttatggcg ctgctgttgc tgacaaatta gacaatggcc 901 gtaatatatt gagacggcgc tattatcgac aacattgcac accagattat ggttcatata 961 ccaaagattt atcagctatt tgtaatgact taaatagaat attcataatt gacaactcgc 1021 cagctgcata tcgttgtttt cctcataatg ctatacccat aaaaagttgg ttttccgacc 1081 caatggatat ttcattattg tcgttacttc caatgttgga tgctttaagg tttacaaatg 1141 atgtccgttc agttttgtcg agaaatttac atctgcatgg cctatggtag caggttaaca 1201 aattaaaaat ttggtgctgt gacacttgaa cgaatttttg tttgtttcat taatttaaat 1261 taattttttc tattatataa gaaattacta aaaatcatgt gaagataaaa cagatttgtt 1321 aatggcaaga catattacat taaataaata aaaaacaatt tcttgacttg