Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans CTD nuclear envelope phosphatase 1


LOCUS       XM_013262581            1370 bp    mRNA    linear   INV 02-SEP-2023
            homolog (LOC106095345), transcript variant X1, mRNA.
ACCESSION   XM_013262581
VERSION     XM_013262581.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262581.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1370
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1370
                     /gene="LOC106095345"
                     /note="CTD nuclear envelope phosphatase 1 homolog; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:106095345"
     CDS             459..1190
                     /gene="LOC106095345"
                     /codon_start=1
                     /product="CTD nuclear envelope phosphatase 1 homolog
                     isoform X1"
                     /protein_id="XP_013118035.1"
                     /db_xref="GeneID:106095345"
                     /translation="MFSLVQMKFRALLVLLSKIWTCICFMFNRQVRAFVQYQPVKYEL
                     FPLSPVSRHRLSIVQRKTLVLDLDETLIHSHHNAMPRNIVKPGTPHDFTVKVTIDRHP
                     VRFFVHKRPHVDFFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHC
                     TPDYGSYTKDLSAICNDLNRIFIIDNSPAAYRCFPHNAIPIKSWFSDPMDISLLSLLP
                     MLDALRFTNDVRSVLSRNLHLHGLW"
     misc_feature    636..1142
                     /gene="LOC106095345"
                     /note="Dullard-like phosphatase domain; Region:
                     HIF-SF_euk; TIGR02251"
                     /db_xref="CDD:274055"
     misc_feature    order(654..668,678..683,843..854,864..866,963..965,
                     1011..1016,1020..1028)
                     /gene="LOC106095345"
                     /note="active site"
                     /db_xref="CDD:319823"
     polyA_site      1370
                     /gene="LOC106095345"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agacggcaac tctgatggta actgcgaaag cggcaatcaa cgaaccaaca caccaaaaat
       61 ataaattcag ttttgtcgtg tagtgtgaga ttgttgtgta cttttatagt gatacgtgaa
      121 aaatgttaaa tcttatattt caataaaaat ggatgcagaa atgaacacgc tgatcaaata
      181 cccttataat ggaatccaat gtagcagaaa tccaacaatt aagtgccgtc gcgtgtaaac
      241 aacaacaaca aaaatagcaa acaatcatca ggcatttgaa acaagcaata agcacccgcc
      301 tcctcttagg tgaaagatag attggtcatt tgttttaaac agatactata ttttgagaat
      361 aggttttggt taaaaaaaaa gtatatacat acatatatat acatagaaat atacataaac
      421 atttatgtag tgttcattgg taagtttctt tcttaccaat gttttccctc gttcaaatga
      481 aattccgtgc tttactggta ctactatcaa aaatatggac gtgcatatgt tttatgttca
      541 atcgtcaagt aagagcattt gtccagtatc aacctgtcaa atatgaacta tttccactgt
      601 cccctgtgtc gcgacaccgc ctcagcattg tacaacggaa gactttggtt ttggatttgg
      661 atgaaacatt aatacattcg catcacaatg ctatgcccag gaatattgtt aaacccggaa
      721 cacctcatga ttttacagtc aaagtaacaa tagatagaca tccggtgaga ttttttgtac
      781 ataaaagacc acatgtcgat ttcttcctag acgtggtttc gcaatggtat gacttggtgg
      841 ttttcacagc cagtatggag atttatggcg ctgctgttgc tgacaaatta gacaatggcc
      901 gtaatatatt gagacggcgc tattatcgac aacattgcac accagattat ggttcatata
      961 ccaaagattt atcagctatt tgtaatgact taaatagaat attcataatt gacaactcgc
     1021 cagctgcata tcgttgtttt cctcataatg ctatacccat aaaaagttgg ttttccgacc
     1081 caatggatat ttcattattg tcgttacttc caatgttgga tgctttaagg tttacaaatg
     1141 atgtccgttc agttttgtcg agaaatttac atctgcatgg cctatggtag caggttaaca
     1201 aattaaaaat ttggtgctgt gacacttgaa cgaatttttg tttgtttcat taatttaaat
     1261 taattttttc tattatataa gaaattacta aaaatcatgt gaagataaaa cagatttgtt
     1321 aatggcaaga catattacat taaataaata aaaaacaatt tcttgacttg