Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262473 1057 bp mRNA linear INV 02-SEP-2023 (LOC106095232), mRNA. ACCESSION XM_013262473 VERSION XM_013262473.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262473.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1057 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1057 /gene="LOC106095232" /note="INO80 complex subunit C; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106095232" CDS 490..954 /gene="LOC106095232" /codon_start=1 /product="INO80 complex subunit C" /protein_id="XP_013117927.1" /db_xref="GeneID:106095232" /translation="MYQGEEVPHKKHKPDSDGILVEKVDSAHAAPCSNPTLPSTSVLQ RPKILCKNTKFSYFETCGKRFVWKSLKQIITQERSLIWPDDIILYNSLNAPPSLKPPK KYSDISGLHAPYTDPQTRLHYHNSDEFRIIRTLPSDIVQGYLALRGATNIVG" misc_feature 610..936 /gene="LOC106095232" /note="YL1 nuclear protein C-terminal domain; Region: YL1_C; cl02154" /db_xref="CDD:470478" polyA_site 1057 /gene="LOC106095232" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgaggttgc aggccttgcc gatgaaggat tccattgggt caatccggta cataaaatcg 61 gttgccatgg gagaaatact gggatgtgca cataccgaaa ttttagttat catatagata 121 agaaaataaa tgacgtcgta tatcgcatcc agaacgatgg tggggcatcg cgtagacact 181 tcctaattga cattttagtt tttatttgca ttatcatttg tagcaaccaa aagttcaaaa 241 gatttgttaa tataaacgtg aagaaaggaa caaatttaaa aatctaaaca taggattttg 301 tattctagtg tgatctgtaa ttggataatt ccatcagctg ggcaagtgac ctaacttatt 361 ttagtgaacc ctgtgacaac ctttttaaat tagccttgca attttactat caattggcac 421 gcagccaaat taaataaaac atatgtgatt atattgtatt tggaaaattt aactgactac 481 tagattaaaa tgtaccaagg ggaagaagta cctcacaaaa aacataaacc tgactccgac 541 ggcattcttg tcgagaaggt tgactcagca catgccgcgc cgtgctcaaa tccaacttta 601 ccctcaacat ctgtactgca gcgacctaaa attttatgca aaaacaccaa gtttagctat 661 tttgaaactt gtggaaaaag atttgtttgg aaatcattga aacagattat aactcaggag 721 agatcactta tttggccgga tgatataatt ttgtataatt ctttgaatgc acctccgtct 781 ctaaaaccac ctaagaagta ttctgatata tccggattac atgcacccta caccgatccg 841 caaacgagac tgcactacca taactctgac gaattccgaa ttattcgcac tttaccgtcc 901 gacatagtac agggttattt agcacttaga ggagccacaa atattgtagg ttaataatac 961 ttttaagaat tttgacaaca taaaattaat attgtttaac aatttttaaa acggttatta 1021 aattggatga atattcgaga tgtcactttt ttgaaaa