Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094943


LOCUS       XM_013262185             565 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094943), mRNA.
ACCESSION   XM_013262185
VERSION     XM_013262185.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262185.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..565
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..565
                     /gene="LOC106094943"
                     /note="uncharacterized LOC106094943; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106094943"
     CDS             7..528
                     /gene="LOC106094943"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094943"
                     /protein_id="XP_013117639.2"
                     /db_xref="GeneID:106094943"
                     /translation="MEKQFWIFFLIFGFLKELQCIKIRLHKTVCNSLDESACRFDSCE
                     VKPNKQNIPSFSADIKLLNGSIDTLVFQSEFYHVFGKNQLLMANRSFDFCEMITNKRK
                     NSVAKFFIDIIATYTTINHSCPFKEDEIFIRNLAVKKFALPGPEGNYLFKMKAVANKK
                     SLFRLDLYMKVIN"
ORIGIN      
        1 tacaaaatgg agaaacaatt ttggatattt tttctaattt ttggtttcct gaaggagttg
       61 cagtgtataa aaattcgctt gcacaaaact gtttgcaact ccctggatga aagcgcctgc
      121 agattcgata gctgtgaggt taaacccaat aaacagaaca ttccctcatt ctcggccgat
      181 ataaaacttc tgaatggctc cattgatact cttgtctttc aatcggaatt ctatcacgtc
      241 tttggcaaga accaattact catggccaat agatcgtttg atttctgtga gatgataacg
      301 aataagcgaa agaattctgt ggccaagttc tttattgaca tcattgcgac ctataccacc
      361 ataaatcatt cgtgcccatt taaggaagat gaaattttta tacgcaattt agctgttaaa
      421 aagtttgcct tgcctggccc agaaggaaat tatctattca agatgaaagc agtcgcgaat
      481 aagaagagtc tctttcgttt ggatttgtac atgaaggtta ttaattagct gaatcatata
      541 tgaatcaatg tcaaattaag cctct