Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262185 565 bp mRNA linear INV 02-SEP-2023 (LOC106094943), mRNA. ACCESSION XM_013262185 VERSION XM_013262185.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262185.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..565 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..565 /gene="LOC106094943" /note="uncharacterized LOC106094943; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094943" CDS 7..528 /gene="LOC106094943" /codon_start=1 /product="uncharacterized protein LOC106094943" /protein_id="XP_013117639.2" /db_xref="GeneID:106094943" /translation="MEKQFWIFFLIFGFLKELQCIKIRLHKTVCNSLDESACRFDSCE VKPNKQNIPSFSADIKLLNGSIDTLVFQSEFYHVFGKNQLLMANRSFDFCEMITNKRK NSVAKFFIDIIATYTTINHSCPFKEDEIFIRNLAVKKFALPGPEGNYLFKMKAVANKK SLFRLDLYMKVIN" ORIGIN 1 tacaaaatgg agaaacaatt ttggatattt tttctaattt ttggtttcct gaaggagttg 61 cagtgtataa aaattcgctt gcacaaaact gtttgcaact ccctggatga aagcgcctgc 121 agattcgata gctgtgaggt taaacccaat aaacagaaca ttccctcatt ctcggccgat 181 ataaaacttc tgaatggctc cattgatact cttgtctttc aatcggaatt ctatcacgtc 241 tttggcaaga accaattact catggccaat agatcgtttg atttctgtga gatgataacg 301 aataagcgaa agaattctgt ggccaagttc tttattgaca tcattgcgac ctataccacc 361 ataaatcatt cgtgcccatt taaggaagat gaaattttta tacgcaattt agctgttaaa 421 aagtttgcct tgcctggccc agaaggaaat tatctattca agatgaaagc agtcgcgaat 481 aagaagagtc tctttcgttt ggatttgtac atgaaggtta ttaattagct gaatcatata 541 tgaatcaatg tcaaattaag cctct