Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262088 529 bp mRNA linear INV 02-SEP-2023 chaperone (LOC106094849), mRNA. ACCESSION XM_013262088 VERSION XM_013262088.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262088.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..529 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..529 /gene="LOC106094849" /note="cytochrome c oxidase copper chaperone; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106094849" CDS 137..343 /gene="LOC106094849" /codon_start=1 /product="cytochrome c oxidase copper chaperone" /protein_id="XP_013117542.2" /db_xref="GeneID:106094849" /translation="MGNAPVKEVANSSTVDAAPAAKPKCKACCACPETKKVRDQCIVE RGESECGDLIEAHKKCMREQGFNI" polyA_site 529 /gene="LOC106094849" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaacagctga cctttcaatg tttttattcc ctcactcgca catgacattg tttttcggaa 61 gcattcattg tcaatattta gcggagagaa aattcttgtc gcttacacaa caacaacgcc 121 agtagccata taaaaaatgg gtaatgctcc agtaaaagaa gttgccaata gcagcacggt 181 ggatgcggct cctgctgcca agccaaagtg caaagcttgc tgtgcctgtc ccgaaaccaa 241 gaaagtcaga gatcagtgta ttgtggagcg tggcgaatct gaatgtggag atcttattga 301 agctcataaa aaatgcatga gggaacaagg attcaacata taaggagctt aaccttaatt 361 agaaattact ttaaatataa aataattatt aacataacca aaaatgtccc ttactttagt 421 gagtatggcc caatcgctca tacaaatcag tttctcgaaa gccaaattac aatctttcga 481 aatatagtca ttatgttata atttttgcga aagaacaatt aaagcttaa