Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome c oxidase copper


LOCUS       XM_013262088             529 bp    mRNA    linear   INV 02-SEP-2023
            chaperone (LOC106094849), mRNA.
ACCESSION   XM_013262088
VERSION     XM_013262088.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262088.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..529
                     /gene="LOC106094849"
                     /note="cytochrome c oxidase copper chaperone; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106094849"
     CDS             137..343
                     /gene="LOC106094849"
                     /codon_start=1
                     /product="cytochrome c oxidase copper chaperone"
                     /protein_id="XP_013117542.2"
                     /db_xref="GeneID:106094849"
                     /translation="MGNAPVKEVANSSTVDAAPAAKPKCKACCACPETKKVRDQCIVE
                     RGESECGDLIEAHKKCMREQGFNI"
     polyA_site      529
                     /gene="LOC106094849"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaacagctga cctttcaatg tttttattcc ctcactcgca catgacattg tttttcggaa
       61 gcattcattg tcaatattta gcggagagaa aattcttgtc gcttacacaa caacaacgcc
      121 agtagccata taaaaaatgg gtaatgctcc agtaaaagaa gttgccaata gcagcacggt
      181 ggatgcggct cctgctgcca agccaaagtg caaagcttgc tgtgcctgtc ccgaaaccaa
      241 gaaagtcaga gatcagtgta ttgtggagcg tggcgaatct gaatgtggag atcttattga
      301 agctcataaa aaatgcatga gggaacaagg attcaacata taaggagctt aaccttaatt
      361 agaaattact ttaaatataa aataattatt aacataacca aaaatgtccc ttactttagt
      421 gagtatggcc caatcgctca tacaaatcag tttctcgaaa gccaaattac aatctttcga
      481 aatatagtca ttatgttata atttttgcga aagaacaatt aaagcttaa