Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262085 929 bp mRNA linear INV 02-SEP-2023 1 (LOC106094848), transcript variant X1, mRNA. ACCESSION XM_013262085 VERSION XM_013262085.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262085.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..929 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..929 /gene="LOC106094848" /note="microsomal glutathione S-transferase 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 Proteins" /db_xref="GeneID:106094848" CDS 337..909 /gene="LOC106094848" /codon_start=1 /product="microsomal glutathione S-transferase 1 isoform X1" /protein_id="XP_013117539.1" /db_xref="GeneID:106094848" /translation="MDASKITSDHTEPSSMHGSSSSKTYNGGLSMLNLENPVFCCFLL WSSVLVVKMLLMSLLTALQRFRNKILGLMPQCLLKKVFPNKEDLFFKNIEVQFDDPNV ERVRRAHRNDMENILPYFTMALLYICTNPNPSVACNLFRVAAVARIIHTLVYAFYPVP QPSRIIAFFTMFGITMYMAFVVGLQTLKYI" misc_feature 460..888 /gene="LOC106094848" /note="MAPEG family; Region: MAPEG; pfam01124" /db_xref="CDD:460074" polyA_site 929 /gene="LOC106094848" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctcaatatca acttgtagct tgagttctat aacaatacat atatgcatta gtatatagtt 61 gtaaggtttc aaaatttaag aagaataaac gaaaacattt tcctgctttc tggttcgaag 121 ttaaatttca aacatcattt gagttaatcg ccgttaaatt tgcaaaccag cgatcattct 181 cgagtcgatc gcacatacga aacatcatct acaatataaa ggtcaaagtt tacttatctt 241 ttgctctata acgagacaaa agcgaaaaaa cactaaaact tcgtcgcatt tattttaaag 301 tagaagcaga acggattttt cttcttcttg ttaagaatgg acgcttcaaa aattacttcc 361 gaccacacag aaccatcttc gatgcatggc agcagcagca gcaaaactta taatggtggt 421 ttatctatgc ttaaccttga gaatccagtc ttctgctgct ttctactatg gtccagtgtc 481 ttggtagtca aaatgttgtt gatgtctttg ctgacagcat tgcagcgttt ccgcaacaag 541 atcttgggtc ttatgccaca atgtcttctt aaaaaggttt ttcccaacaa agaggatttg 601 ttctttaaaa atattgaggt gcaatttgat gatcccaatg tggagagagt acgaagagcc 661 catcgtaatg atatggaaaa cattctgccc tatttcacca tggccttact ctacatctgt 721 accaatccaa atccctccgt agcatgtaat cttttccgtg tggctgctgt ggcccgtata 781 atacacactt tagtctatgc gttctatccg gtaccacaac cttccaggat aatagctttc 841 ttcaccatgt ttggaataac catgtacatg gcttttgttg ttggtttgca aaccttaaaa 901 tatatttaag cttaaatgtt gttaaacaa