Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans microsomal glutathione S-transferase


LOCUS       XM_013262085             929 bp    mRNA    linear   INV 02-SEP-2023
            1 (LOC106094848), transcript variant X1, mRNA.
ACCESSION   XM_013262085
VERSION     XM_013262085.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262085.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..929
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..929
                     /gene="LOC106094848"
                     /note="microsomal glutathione S-transferase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 17 Proteins"
                     /db_xref="GeneID:106094848"
     CDS             337..909
                     /gene="LOC106094848"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1 isoform
                     X1"
                     /protein_id="XP_013117539.1"
                     /db_xref="GeneID:106094848"
                     /translation="MDASKITSDHTEPSSMHGSSSSKTYNGGLSMLNLENPVFCCFLL
                     WSSVLVVKMLLMSLLTALQRFRNKILGLMPQCLLKKVFPNKEDLFFKNIEVQFDDPNV
                     ERVRRAHRNDMENILPYFTMALLYICTNPNPSVACNLFRVAAVARIIHTLVYAFYPVP
                     QPSRIIAFFTMFGITMYMAFVVGLQTLKYI"
     misc_feature    460..888
                     /gene="LOC106094848"
                     /note="MAPEG family; Region: MAPEG; pfam01124"
                     /db_xref="CDD:460074"
     polyA_site      929
                     /gene="LOC106094848"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcaatatca acttgtagct tgagttctat aacaatacat atatgcatta gtatatagtt
       61 gtaaggtttc aaaatttaag aagaataaac gaaaacattt tcctgctttc tggttcgaag
      121 ttaaatttca aacatcattt gagttaatcg ccgttaaatt tgcaaaccag cgatcattct
      181 cgagtcgatc gcacatacga aacatcatct acaatataaa ggtcaaagtt tacttatctt
      241 ttgctctata acgagacaaa agcgaaaaaa cactaaaact tcgtcgcatt tattttaaag
      301 tagaagcaga acggattttt cttcttcttg ttaagaatgg acgcttcaaa aattacttcc
      361 gaccacacag aaccatcttc gatgcatggc agcagcagca gcaaaactta taatggtggt
      421 ttatctatgc ttaaccttga gaatccagtc ttctgctgct ttctactatg gtccagtgtc
      481 ttggtagtca aaatgttgtt gatgtctttg ctgacagcat tgcagcgttt ccgcaacaag
      541 atcttgggtc ttatgccaca atgtcttctt aaaaaggttt ttcccaacaa agaggatttg
      601 ttctttaaaa atattgaggt gcaatttgat gatcccaatg tggagagagt acgaagagcc
      661 catcgtaatg atatggaaaa cattctgccc tatttcacca tggccttact ctacatctgt
      721 accaatccaa atccctccgt agcatgtaat cttttccgtg tggctgctgt ggcccgtata
      781 atacacactt tagtctatgc gttctatccg gtaccacaac cttccaggat aatagctttc
      841 ttcaccatgt ttggaataac catgtacatg gcttttgttg ttggtttgca aaccttaaaa
      901 tatatttaag cttaaatgtt gttaaacaa