Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans dynein axonemal light chain 1


LOCUS       XM_013262083             707 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094846), mRNA.
ACCESSION   XM_013262083
VERSION     XM_013262083.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262083.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..707
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..707
                     /gene="LOC106094846"
                     /note="dynein axonemal light chain 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106094846"
     CDS             53..607
                     /gene="LOC106094846"
                     /codon_start=1
                     /product="dynein axonemal light chain 1"
                     /protein_id="XP_013117537.2"
                     /db_xref="GeneID:106094846"
                     /translation="MAKPTTIKEALTKWEERTKEDSTKATDIGLQFQYLPIEKMDGTL
                     GTLIECRKLSLSSNMIEKINGIGNMKNLKILSLARNRLKTLNGIEPLANTLEELWVSY
                     NLIEKLKPIESMKALKVLYISQNSIKDWSEFNRMGAAPKLENISFIGNPLYESMDEAT
                     FRSEAIRRLPNLKQLDSEPVIRGD"
     polyA_site      707
                     /gene="LOC106094846"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcacttatc agaaaatttt gaaactaaca tccataaacc aatagcttgg acatggccaa
       61 accaaccacc atcaaagaag ctctaacaaa atgggaggag cgcactaaag aagattctac
      121 caaggctact gatattggat tacaattcca atatctaccc atagagaaaa tggacggtac
      181 actagggaca ctgatcgaat gtcgcaaatt aagtttgtca tcgaatatga ttgaaaaaat
      241 caacggcatc ggcaatatga aaaatttgaa aattctttcc ctagcaagaa atcgtttaaa
      301 aactttaaat ggaattgaac ccttagcaaa tactctggag gaattgtggg ttagctataa
      361 tctgattgag aaattaaaac ccattgaatc tatgaaagct ttgaaagttc tatatatatc
      421 tcaaaattcc ataaaagatt ggtccgaatt caatcgtatg ggggctgctc ctaagttaga
      481 gaatatatcg ttcattggca atcctttata tgaatctatg gatgaagcaa catttcgctc
      541 tgaggctata agacgtttgc caaatcttaa gcaattggac agtgaaccag ttataagagg
      601 ggattaaata tataactctt gtatatatct tttattttat tttcctatgc ctgtgcgcat
      661 atgtaacgaa atttatatga taaagaactt tggtaatatt aatatca