Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262083 707 bp mRNA linear INV 02-SEP-2023 (LOC106094846), mRNA. ACCESSION XM_013262083 VERSION XM_013262083.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262083.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..707 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..707 /gene="LOC106094846" /note="dynein axonemal light chain 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106094846" CDS 53..607 /gene="LOC106094846" /codon_start=1 /product="dynein axonemal light chain 1" /protein_id="XP_013117537.2" /db_xref="GeneID:106094846" /translation="MAKPTTIKEALTKWEERTKEDSTKATDIGLQFQYLPIEKMDGTL GTLIECRKLSLSSNMIEKINGIGNMKNLKILSLARNRLKTLNGIEPLANTLEELWVSY NLIEKLKPIESMKALKVLYISQNSIKDWSEFNRMGAAPKLENISFIGNPLYESMDEAT FRSEAIRRLPNLKQLDSEPVIRGD" polyA_site 707 /gene="LOC106094846" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcacttatc agaaaatttt gaaactaaca tccataaacc aatagcttgg acatggccaa 61 accaaccacc atcaaagaag ctctaacaaa atgggaggag cgcactaaag aagattctac 121 caaggctact gatattggat tacaattcca atatctaccc atagagaaaa tggacggtac 181 actagggaca ctgatcgaat gtcgcaaatt aagtttgtca tcgaatatga ttgaaaaaat 241 caacggcatc ggcaatatga aaaatttgaa aattctttcc ctagcaagaa atcgtttaaa 301 aactttaaat ggaattgaac ccttagcaaa tactctggag gaattgtggg ttagctataa 361 tctgattgag aaattaaaac ccattgaatc tatgaaagct ttgaaagttc tatatatatc 421 tcaaaattcc ataaaagatt ggtccgaatt caatcgtatg ggggctgctc ctaagttaga 481 gaatatatcg ttcattggca atcctttata tgaatctatg gatgaagcaa catttcgctc 541 tgaggctata agacgtttgc caaatcttaa gcaattggac agtgaaccag ttataagagg 601 ggattaaata tataactctt gtatatatct tttattttat tttcctatgc ctgtgcgcat 661 atgtaacgaa atttatatga taaagaactt tggtaatatt aatatca