Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013262049 535 bp mRNA linear INV 02-SEP-2023 protein-like (LOC106094811), mRNA. ACCESSION XM_013262049 VERSION XM_013262049.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013262049.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..535 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..535 /gene="LOC106094811" /note="fibrous sheath CABYR-binding protein-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094811" CDS 54..461 /gene="LOC106094811" /codon_start=1 /product="fibrous sheath CABYR-binding protein-like" /protein_id="XP_013117503.1" /db_xref="GeneID:106094811" /translation="MKFVLIALALLGAVAADVSHLSNEYLPPHEAEVNKEYLPPHMEA LLSHNHVEYAEQTNEVPQEEEPAPVVEEAAEESASEFQQSYAADEPEDSSSNTVEEQA APEPAPVDIPQSYESSASSGVETQYGENGGYVY" polyA_site 535 /gene="LOC106094811" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcagtgcgga atttcgggtc tgtgcagtca catcacgtaa gaaattgata acaatgaaat 61 tcgtcttaat tgccttggcc cttttgggtg ccgttgccgc tgatgtcagc cacttgagca 121 atgaatacct gccaccacat gaagctgaag tgaacaaaga atacctgccc ccacatatgg 181 aagctttgtt gtctcacaat catgtggaat atgccgaaca aaccaatgaa gtgccccagg 241 aagaggaacc agcccccgtg gttgaggaag cagccgaaga gtctgcctca gaattccaac 301 aaagctatgc cgctgatgaa cccgaagact cttcctcaaa cacggttgag gagcaagccg 361 cccccgaacc agcacctgtt gacattcctc aatcctatga atccagtgcc tcctcaggtg 421 tagaaaccca atatggcgag aatggtggat acgtttatta gattttgttt taatttttca 481 ttagtatgaa attagcttgt atttagatta gggaataaat tattgacaaa ttcaa