Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrous sheath CABYR-binding


LOCUS       XM_013262049             535 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106094811), mRNA.
ACCESSION   XM_013262049
VERSION     XM_013262049.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013262049.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..535
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..535
                     /gene="LOC106094811"
                     /note="fibrous sheath CABYR-binding protein-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106094811"
     CDS             54..461
                     /gene="LOC106094811"
                     /codon_start=1
                     /product="fibrous sheath CABYR-binding protein-like"
                     /protein_id="XP_013117503.1"
                     /db_xref="GeneID:106094811"
                     /translation="MKFVLIALALLGAVAADVSHLSNEYLPPHEAEVNKEYLPPHMEA
                     LLSHNHVEYAEQTNEVPQEEEPAPVVEEAAEESASEFQQSYAADEPEDSSSNTVEEQA
                     APEPAPVDIPQSYESSASSGVETQYGENGGYVY"
     polyA_site      535
                     /gene="LOC106094811"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagtgcgga atttcgggtc tgtgcagtca catcacgtaa gaaattgata acaatgaaat
       61 tcgtcttaat tgccttggcc cttttgggtg ccgttgccgc tgatgtcagc cacttgagca
      121 atgaatacct gccaccacat gaagctgaag tgaacaaaga atacctgccc ccacatatgg
      181 aagctttgtt gtctcacaat catgtggaat atgccgaaca aaccaatgaa gtgccccagg
      241 aagaggaacc agcccccgtg gttgaggaag cagccgaaga gtctgcctca gaattccaac
      301 aaagctatgc cgctgatgaa cccgaagact cttcctcaaa cacggttgag gagcaagccg
      361 cccccgaacc agcacctgtt gacattcctc aatcctatga atccagtgcc tcctcaggtg
      421 tagaaaccca atatggcgag aatggtggat acgtttatta gattttgttt taatttttca
      481 ttagtatgaa attagcttgt atttagatta gggaataaat tattgacaaa ttcaa