Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094602


LOCUS       XM_013261829            1416 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094602), mRNA.
ACCESSION   XM_013261829
VERSION     XM_013261829.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261829.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1416
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1416
                     /gene="LOC106094602"
                     /note="uncharacterized LOC106094602; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106094602"
     CDS             1..1416
                     /gene="LOC106094602"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094602"
                     /protein_id="XP_013117283.2"
                     /db_xref="GeneID:106094602"
                     /translation="MSLPFRTVINNLNLLSVTATLLLIRHVLGTLANDNFLYAVHSGN
                     ENIFHHTLLGIDQEHAIQSLLLLKHQSFEDDGVIEDFYRFPRPKVIVTHNVTFKFFEE
                     FNTAMLTVFVAQNQLDLELLKNAADILHMRRQSRIWAIALDIEDKELFKKQLLEACQY
                     YKMTNVLLSFIHTNSPEDIFNYALKPYNTYHWIPKTMNCNHCSYYPQHWRNFQNTSII
                     TYTSQNPPSAFVFMDESENIKIVGYVASFVLAFAQIFNASLEMYQPLELQETLANKHL
                     NQMAREGKLDLPMALTENSQQTSMGHESNYYDIIKPLIIVPCSGRMNIRQVYGILLNE
                     YFFGCVILCSVSLSILHSLIDYCFDGLWNRLNFLLNHRIFPGLLGYSFATRNSPWRGL
                     KILYLLVFLAGLNISIQFASKISTLLTDQPHNRQILTYKDLRRSSLKILIDQLYGEAV
                     KREYTLLAKSMKTTSLLTYIG"
ORIGIN      
        1 atgagccttc cgttccgaac ggttattaat aatctaaatt tgcttagtgt cacagcaacg
       61 cttttactca tacgccatgt tttaggcact ttggcaaacg ataacttcct ctatgcagtg
      121 catagcggta atgagaacat attccaccac acattacttg gcattgatca ggaacatgca
      181 atacaatcgc tcttgctgct taaacaccaa tcatttgaag atgacggtgt gattgaggac
      241 ttttatagat ttccccggcc aaaggtgata gtcacacaca atgtgacatt taagtttttc
      301 gaggaattta atacagctat gcttacagtg tttgtggccc agaatcaact ggatcttgaa
      361 ctgttgaaga atgctgcaga cattttgcac atgagacgtc aaagtagaat atgggcaata
      421 gccttagata tcgaggacaa ggaattgttt aaaaagcaac ttctggaagc ttgtcaatac
      481 tacaaaatga ccaatgtctt attgagcttc attcacacca atagcccaga ggatatcttc
      541 aattatgccc ttaaacccta taacacctat cattggattc ctaagacaat gaattgcaat
      601 cattgcagct attaccccca acattggcgt aattttcaaa acacctctat aatcacctac
      661 accagccaga atcctccaag tgcctttgtg tttatggatg aaagcgaaaa tatcaaaatc
      721 gtaggttatg tggcaagttt tgtgttggcc tttgcccaaa tcttcaatgc cagtttggaa
      781 atgtatcaac ctttggaact acaggagacg ctagccaaca aacacctcaa ccaaatggcc
      841 cgggagggta aattggatct acccatggct ctgactgaaa attcgcagca aaccagcatg
      901 ggacatgaat ccaactatta tgacattata aagcctttaa ttatagtacc ctgtagcggc
      961 cgcatgaata ttcgccaagt atatggaatt ttgctcaatg aatacttctt tggctgcgtt
     1021 attttatgct ccgtctcatt atcgatcctg cattctctca ttgactattg ttttgatggc
     1081 ctctggaatc gtttgaactt tttactaaat catagaatct ttccgggtct gttgggctat
     1141 tcctttgcta cgcgcaactc tccttggcga ggcttgaaaa ttctctatct tttagttttc
     1201 ttagctggcc tcaatatttc catacaattt gcatctaaaa taagcaccct attgaccgac
     1261 caacctcata atcggcaaat tttaacctat aaagacttga ggagatcctc gctaaagatt
     1321 ttgatagacc aattgtatgg cgaggcagta aaaagagaat acactcttct ggcaaaatcc
     1381 atgaaaacca cttcgttatt gacatatatc ggatag