Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261709 747 bp mRNA linear INV 02-SEP-2023 (LOC106094480), mRNA. ACCESSION XM_013261709 VERSION XM_013261709.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261709.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..747 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..747 /gene="LOC106094480" /note="uncharacterized LOC106094480; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106094480" CDS 47..679 /gene="LOC106094480" /codon_start=1 /product="uncharacterized protein LOC106094480" /protein_id="XP_013117163.2" /db_xref="GeneID:106094480" /translation="MVDAIFNGLVVGTSSYALSQLQPSESPFLFTACAMGLCHGLLSL YGNIMEGSSNSENAATYPGPSDSMVRRLQSLTESCVEIASVPLINMDFYLRSQQSSPL AMGHGLFVIPLMVDLSWQLFSGNQNGNGTETLKELNTLGNIVSLVFLSVNEGNLAYGI MAVSALMAQYGPMIMENSLRGSGANTALIGYSLFFALIPAALSDGGQQTA" polyA_site 747 /gene="LOC106094480" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttggttttaa ctcagaaact aaaagtcctt cgaaattcaa ttcaaaatgg ttgatgccat 61 tttcaatggc cttgtggtgg gtacctctag ctatgctttg agtcaacttc aaccctcgga 121 aagtcccttc cttttcaccg cctgtgccat gggcttatgt catggtcttc tcagccttta 181 tggcaatatc atggagggct ccagcaatag cgaaaatgca gccacatatc caggccccag 241 cgatagtatg gtgcggagat tacaaagtct cacggagagc tgtgtggaaa tcgcaagtgt 301 tcctcttatc aatatggact tttatctaag atctcagcaa tcttctcccc tggctatggg 361 tcatggtctc ttcgttatac ctttgatggt ggacttgtca tggcaactgt tcagtggaaa 421 tcaaaatgga aatggcactg aaactctgaa ggaactgaac acattgggta atattgtgtc 481 gctggtattt ctttcggtga atgagggtaa tttggcctat ggtataatgg ctgtgtcggc 541 tttaatggcc caatatgggc ccatgataat ggagaattcg ctgaggggat cgggtgcaaa 601 tactgcttta attggatatt cattattttt tgccttgata ccagctgccc ttagtgatgg 661 gggtcaacag acggcttaaa tacagaaaaa ttattaaaat tttttgtaat gaaataaaaa 721 tccattttta aaatttcgat gctaaaa