Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094480


LOCUS       XM_013261709             747 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094480), mRNA.
ACCESSION   XM_013261709
VERSION     XM_013261709.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261709.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..747
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..747
                     /gene="LOC106094480"
                     /note="uncharacterized LOC106094480; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106094480"
     CDS             47..679
                     /gene="LOC106094480"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094480"
                     /protein_id="XP_013117163.2"
                     /db_xref="GeneID:106094480"
                     /translation="MVDAIFNGLVVGTSSYALSQLQPSESPFLFTACAMGLCHGLLSL
                     YGNIMEGSSNSENAATYPGPSDSMVRRLQSLTESCVEIASVPLINMDFYLRSQQSSPL
                     AMGHGLFVIPLMVDLSWQLFSGNQNGNGTETLKELNTLGNIVSLVFLSVNEGNLAYGI
                     MAVSALMAQYGPMIMENSLRGSGANTALIGYSLFFALIPAALSDGGQQTA"
     polyA_site      747
                     /gene="LOC106094480"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggttttaa ctcagaaact aaaagtcctt cgaaattcaa ttcaaaatgg ttgatgccat
       61 tttcaatggc cttgtggtgg gtacctctag ctatgctttg agtcaacttc aaccctcgga
      121 aagtcccttc cttttcaccg cctgtgccat gggcttatgt catggtcttc tcagccttta
      181 tggcaatatc atggagggct ccagcaatag cgaaaatgca gccacatatc caggccccag
      241 cgatagtatg gtgcggagat tacaaagtct cacggagagc tgtgtggaaa tcgcaagtgt
      301 tcctcttatc aatatggact tttatctaag atctcagcaa tcttctcccc tggctatggg
      361 tcatggtctc ttcgttatac ctttgatggt ggacttgtca tggcaactgt tcagtggaaa
      421 tcaaaatgga aatggcactg aaactctgaa ggaactgaac acattgggta atattgtgtc
      481 gctggtattt ctttcggtga atgagggtaa tttggcctat ggtataatgg ctgtgtcggc
      541 tttaatggcc caatatgggc ccatgataat ggagaattcg ctgaggggat cgggtgcaaa
      601 tactgcttta attggatatt cattattttt tgccttgata ccagctgccc ttagtgatgg
      661 gggtcaacag acggcttaaa tacagaaaaa ttattaaaat tttttgtaat gaaataaaaa
      721 tccattttta aaatttcgat gctaaaa