Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094407


LOCUS       XM_013261620             623 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094407), mRNA.
ACCESSION   XM_013261620
VERSION     XM_013261620.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261620.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..623
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..623
                     /gene="LOC106094407"
                     /note="uncharacterized LOC106094407; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106094407"
     CDS             87..578
                     /gene="LOC106094407"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094407"
                     /protein_id="XP_013117074.2"
                     /db_xref="GeneID:106094407"
                     /translation="MKIFIYLLALQLFIKLSSVNGAAIICEEKKASKTNEETVDKLNH
                     NTSSHHLQHNSHKQHYNETNKLNKFLHKIQCSLEKAKPWIDELEQETKRLEEAAKILG
                     IGILNSFGDFINKLSEDGPTLGQTIGMNVTASTEGVTTEEIPVILCPDGFVADYNGIC
                     ERI"
     polyA_site      623
                     /gene="LOC106094407"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtctacttta tcacgttgat ggtcaaagaa cctttatttc ttgctaaaac aaaaaccaag
       61 agtaaataca tctcaacttc tctaaaatga aaatttttat atatttgttg gcactacaat
      121 tattcatcaa acttagttca gtaaatggtg cagccataat ttgtgaagaa aagaaggctt
      181 ccaaaacaaa tgaagaaact gtggataaac ttaaccacaa tacctcaagt catcacttgc
      241 agcacaactc gcacaagcaa cactacaatg aaaccaataa actgaataaa ttcttgcata
      301 aaatacagtg ttctctcgag aaggccaaac catggatcga tgaattggaa caggaaacaa
      361 agcgtttaga ggaagcggct aaaattttgg gtattggcat actgaatagt tttggagatt
      421 ttattaacaa attatccgag gatggcccaa cattagggca aactatagga atgaatgtaa
      481 cagcctcaac ggaaggggtg acgacggaag aaatacctgt aatattatgt cccgatggtt
      541 tcgtagccga ttacaatggc atttgtgaaa ggatttaaat ttatttaatt aaatttaaat
      601 caatcttcaa tgagtttaaa att