Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261620 623 bp mRNA linear INV 02-SEP-2023 (LOC106094407), mRNA. ACCESSION XM_013261620 VERSION XM_013261620.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261620.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..623 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..623 /gene="LOC106094407" /note="uncharacterized LOC106094407; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106094407" CDS 87..578 /gene="LOC106094407" /codon_start=1 /product="uncharacterized protein LOC106094407" /protein_id="XP_013117074.2" /db_xref="GeneID:106094407" /translation="MKIFIYLLALQLFIKLSSVNGAAIICEEKKASKTNEETVDKLNH NTSSHHLQHNSHKQHYNETNKLNKFLHKIQCSLEKAKPWIDELEQETKRLEEAAKILG IGILNSFGDFINKLSEDGPTLGQTIGMNVTASTEGVTTEEIPVILCPDGFVADYNGIC ERI" polyA_site 623 /gene="LOC106094407" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtctacttta tcacgttgat ggtcaaagaa cctttatttc ttgctaaaac aaaaaccaag 61 agtaaataca tctcaacttc tctaaaatga aaatttttat atatttgttg gcactacaat 121 tattcatcaa acttagttca gtaaatggtg cagccataat ttgtgaagaa aagaaggctt 181 ccaaaacaaa tgaagaaact gtggataaac ttaaccacaa tacctcaagt catcacttgc 241 agcacaactc gcacaagcaa cactacaatg aaaccaataa actgaataaa ttcttgcata 301 aaatacagtg ttctctcgag aaggccaaac catggatcga tgaattggaa caggaaacaa 361 agcgtttaga ggaagcggct aaaattttgg gtattggcat actgaatagt tttggagatt 421 ttattaacaa attatccgag gatggcccaa cattagggca aactatagga atgaatgtaa 481 cagcctcaac ggaaggggtg acgacggaag aaatacctgt aatattatgt cccgatggtt 541 tcgtagccga ttacaatggc atttgtgaaa ggatttaaat ttatttaatt aaatttaaat 601 caatcttcaa tgagtttaaa att