Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261619 531 bp mRNA linear INV 02-SEP-2023 (LOC106094406), mRNA. ACCESSION XM_013261619 VERSION XM_013261619.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261619.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..531 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..531 /gene="LOC106094406" /note="uncharacterized LOC106094406; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106094406" CDS 1..531 /gene="LOC106094406" /codon_start=1 /product="uncharacterized protein LOC106094406" /protein_id="XP_013117073.2" /db_xref="GeneID:106094406" /translation="MKHPLLLLAALMLIFSALSTKADLLECDDSVLPSISDMPIIGPK ITSEEDNRSSKVKDVIKEWSCKFKKTTANIGDNVREKTKQWAEGIRESFKKLKEKSKD LHKKFETKYQDFKDRLNKDSGEFVEIKEKKLFFKPDDLIKVDTLKIDASVECGHGHIL DALGNCKKLKDYDGMK" ORIGIN 1 atgaagcacc cgctactgtt attggcagcc ttaatgctga tattctccgc cttgtccacc 61 aaagcggatt tattagaatg cgatgacagc gtactgccat cgatatcgga tatgccaatt 121 attggcccca agataactag cgaagaggat aataggagtt ccaaagtcaa ggatgtcatc 181 aaagaatgga gttgtaaatt taagaagact actgccaaca ttggcgacaa tgttcgtgaa 241 aagacaaagc agtgggcaga aggtatacgt gaaagcttca aaaagctaaa ggaaaaatcc 301 aaggacttac acaagaaatt cgaaacaaaa tatcaggatt tcaaggatcg tttgaataag 361 gattccgggg aatttgtgga gatcaaagag aaaaaacttt tcttcaaacc cgatgatctc 421 ataaaggtcg atacattgaa gatagatgca agtgttgaat gtggacatgg tcacatactg 481 gatgcattgg gtaattgtaa gaaactaaaa gactacgatg gtatgaaatg a