PREDICTED: Stomoxys calcitrans uncharacterized LOC106094406

LOCUS       XM_013261619             531 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094406), mRNA.
ACCESSION   XM_013261619
VERSION     XM_013261619.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261619.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..531
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..531
                     /gene="LOC106094406"
                     /note="uncharacterized LOC106094406; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106094406"
     CDS             1..531
                     /gene="LOC106094406"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094406"
                     /protein_id="XP_013117073.2"
                     /db_xref="GeneID:106094406"
                     /translation="MKHPLLLLAALMLIFSALSTKADLLECDDSVLPSISDMPIIGPK
                     ITSEEDNRSSKVKDVIKEWSCKFKKTTANIGDNVREKTKQWAEGIRESFKKLKEKSKD
                     LHKKFETKYQDFKDRLNKDSGEFVEIKEKKLFFKPDDLIKVDTLKIDASVECGHGHIL
                     DALGNCKKLKDYDGMK"
ORIGIN      
        1 atgaagcacc cgctactgtt attggcagcc ttaatgctga tattctccgc cttgtccacc
       61 aaagcggatt tattagaatg cgatgacagc gtactgccat cgatatcgga tatgccaatt
      121 attggcccca agataactag cgaagaggat aataggagtt ccaaagtcaa ggatgtcatc
      181 aaagaatgga gttgtaaatt taagaagact actgccaaca ttggcgacaa tgttcgtgaa
      241 aagacaaagc agtgggcaga aggtatacgt gaaagcttca aaaagctaaa ggaaaaatcc
      301 aaggacttac acaagaaatt cgaaacaaaa tatcaggatt tcaaggatcg tttgaataag
      361 gattccgggg aatttgtgga gatcaaagag aaaaaacttt tcttcaaacc cgatgatctc
      421 ataaaggtcg atacattgaa gatagatgca agtgttgaat gtggacatgg tcacatactg
      481 gatgcattgg gtaattgtaa gaaactaaaa gactacgatg gtatgaaatg a