Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261616 802 bp mRNA linear INV 02-SEP-2023 (LOC106094402), mRNA. ACCESSION XM_013261616 VERSION XM_013261616.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261616.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..802 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..802 /gene="LOC106094402" /note="uncharacterized LOC106094402; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106094402" CDS 146..652 /gene="LOC106094402" /codon_start=1 /product="uncharacterized protein LOC106094402" /protein_id="XP_013117070.1" /db_xref="GeneID:106094402" /translation="MKHQLVLTTALLLAFCALSTNADLLDCDEKKLPTLADIPGIGPK VSSSEDTGDKVKDTLKDWGCKLKKGASNLGDSVKEKSKQWGEDVAEGFKKLKEKSKDL HSQIETKFHDIKERLSGDSHELVNNKDKKFFMENVEMINPDILKADQECGHGHILDAL GNCKKLRK" misc_feature <293..499 /gene="LOC106094402" /note="Gas vesicle protein YhaH [General function prediction only]; Region: GvpP; COG4980" /db_xref="CDD:444004" polyA_site 802 /gene="LOC106094402" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctcagctaa taaaataaca tcagtatttc gcgaatcgtc aacgaaatcg cacacgcaaa 61 aaagaaagaa aagctatagc tgccgcatta ctctccctcc tctcaagtca agtgaaaaaa 121 gtctcaattc gtttgaagtt gaacaatgaa acatcaattg gtattgacca cagcccttct 181 attggcattt tgtgccttgt cgacaaatgc agatttactc gattgtgatg aaaagaaatt 241 gcccacactc gctgatatac ctggcatagg tcccaaggtt tccagttccg aagataccgg 301 cgataaagtt aaagacacac tcaaagattg gggttgcaaa ctcaagaagg gtgccagcaa 361 tctgggagac agtgtgaaag aaaaatccaa acaatgggga gaggatgttg ccgaaggttt 421 caaaaaactc aaagagaagt ccaaagattt gcactcacaa atcgaaacca agtttcatga 481 cataaaggaa cgcctgagcg gagattccca tgaacttgtc aacaataagg acaagaaatt 541 cttcatggaa aatgttgaaa tgatcaatcc ggatattttg aaggccgatc aggaatgtgg 601 tcatggccat atattggatg cattgggcaa ttgcaagaaa ctacgaaaat aaactcgtta 661 acagctaaag ttttaggaaa actaaaaaaa caactattta actgagataa acaattgcca 721 aagtgtgtct ttttaatttt tgttagtaaa tgtattaaaa agcaatatat atttttaata 781 aagtgcgtga tgaatagaat aa