Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131993967


LOCUS       XM_013261604             739 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131993967), mRNA.
ACCESSION   XM_013261604
VERSION     XM_013261604.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261604.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..739
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..739
                     /gene="LOC131993967"
                     /note="uncharacterized LOC131993967; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:131993967"
     CDS             3..683
                     /gene="LOC131993967"
                     /codon_start=1
                     /product="uncharacterized protein LOC131993967"
                     /protein_id="XP_013117058.2"
                     /db_xref="GeneID:131993967"
                     /translation="MCLVDSKKKLSCLTFCPKLGEKIDEHILKQSKLEGETLQQLLAL
                     EKEFREHNAVIKNELLTQKELISRMWVLSQRYILITSTGTCCKFPEIFAGPAEEIILQ
                     EYCEKLKALKTSNCRISVSLKDLRTSCRLFETLCSQLDMNLQTPFIIGDAYHKPLAFF
                     IELVSDLFKYFHAWLLKLKYNSQLLDPYKAEGMEHYKTLIEPSEEFEEYLNMGLTYCK
                     CLKPKAAC"
     polyA_site      739
                     /gene="LOC131993967"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acatgtgcct tgttgatagt aaaaaaaaac taagttgttt aacattttgt ccaaaattag
       61 gagaaaaaat agatgaacat atattaaaac aaagcaaact cgaaggggag actttgcaac
      121 agctattagc acttgaaaag gaatttcgtg aacacaatgc agtaataaaa aacgagctac
      181 taactcagaa agaattaatc tctaggatgt gggtgttatc acagagatat attctaatta
      241 caagcactgg aacttgttgc aaatttccag aaatatttgc cgggccagcc gaagaaatca
      301 tattgcaaga atattgtgaa aaacttaaag ctcttaaaac ctcgaactgc cgcatatcag
      361 tttctttaaa agatttaaga acatcttgtc gtttatttga aaccctgtgc tcccaattgg
      421 atatgaatct tcaaacacca ttcataattg gagatgccta tcataaacct ttagcatttt
      481 ttattgaact agttagtgat ttgtttaaat actttcatgc atggttattg aaattgaagt
      541 acaattcaca actactagac ccttataaag ccgagggaat ggaacactat aagactttga
      601 tagaaccctc cgaagagttc gaggaatatc ttaatatggg cctaacatac tgtaaatgcc
      661 ttaagccaaa agctgcttgt tgaaaaaaaa atatatacac agttttttgt tggaaagcaa
      721 aaaactaagt gtacccaaa