Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261604 739 bp mRNA linear INV 02-SEP-2023 (LOC131993967), mRNA. ACCESSION XM_013261604 VERSION XM_013261604.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261604.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..739 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..739 /gene="LOC131993967" /note="uncharacterized LOC131993967; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:131993967" CDS 3..683 /gene="LOC131993967" /codon_start=1 /product="uncharacterized protein LOC131993967" /protein_id="XP_013117058.2" /db_xref="GeneID:131993967" /translation="MCLVDSKKKLSCLTFCPKLGEKIDEHILKQSKLEGETLQQLLAL EKEFREHNAVIKNELLTQKELISRMWVLSQRYILITSTGTCCKFPEIFAGPAEEIILQ EYCEKLKALKTSNCRISVSLKDLRTSCRLFETLCSQLDMNLQTPFIIGDAYHKPLAFF IELVSDLFKYFHAWLLKLKYNSQLLDPYKAEGMEHYKTLIEPSEEFEEYLNMGLTYCK CLKPKAAC" polyA_site 739 /gene="LOC131993967" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acatgtgcct tgttgatagt aaaaaaaaac taagttgttt aacattttgt ccaaaattag 61 gagaaaaaat agatgaacat atattaaaac aaagcaaact cgaaggggag actttgcaac 121 agctattagc acttgaaaag gaatttcgtg aacacaatgc agtaataaaa aacgagctac 181 taactcagaa agaattaatc tctaggatgt gggtgttatc acagagatat attctaatta 241 caagcactgg aacttgttgc aaatttccag aaatatttgc cgggccagcc gaagaaatca 301 tattgcaaga atattgtgaa aaacttaaag ctcttaaaac ctcgaactgc cgcatatcag 361 tttctttaaa agatttaaga acatcttgtc gtttatttga aaccctgtgc tcccaattgg 421 atatgaatct tcaaacacca ttcataattg gagatgccta tcataaacct ttagcatttt 481 ttattgaact agttagtgat ttgtttaaat actttcatgc atggttattg aaattgaagt 541 acaattcaca actactagac ccttataaag ccgagggaat ggaacactat aagactttga 601 tagaaccctc cgaagagttc gaggaatatc ttaatatggg cctaacatac tgtaaatgcc 661 ttaagccaaa agctgcttgt tgaaaaaaaa atatatacac agttttttgt tggaaagcaa 721 aaaactaagt gtacccaaa