Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cyclin-dependent kinase 10


LOCUS       XM_013261603            1346 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094391), transcript variant X1, mRNA.
ACCESSION   XM_013261603
VERSION     XM_013261603.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261603.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1346
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1346
                     /gene="LOC106094391"
                     /note="cyclin-dependent kinase 10; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     Proteins"
                     /db_xref="GeneID:106094391"
     CDS             99..1262
                     /gene="LOC106094391"
                     /codon_start=1
                     /product="cyclin-dependent kinase 10 isoform X1"
                     /protein_id="XP_013117057.1"
                     /db_xref="GeneID:106094391"
                     /translation="MSKGDTDPVAPVTRKGFLISIKTGEPTEIRERDVHGRCRAVTEF
                     EKLNRIGEGTYGIVYRARDTRTNEIVALKKVRMDQEKDGLPVSGLREITILKKCKHEN
                     IVNLRDVVVGKSLESIFLVMEYCEQDLASLLDNMAQPFSESEVKCIVLQVLQGLKYMH
                     SRYIIHRDLKVSNLLMTDKGCVKIADFGLARLFGLPSGPMTPQVVTLWYRSPELLLGS
                     PTQTTAVDMWAVGCILGELLSHKPLLPGNTEIAQLELIIDLLGTPSEAIWPDYPKMPA
                     IQNFTLKKQPYNNLKPKFQYLSAAGLRLLNFLFMYDPKKRATPEECLHSTYFKEPPLP
                     CDPKLMPTFPQHRNMQHNSTKSAPSGAHHSGPVPELPAISDLLGSLLKKRRVD"
     misc_feature    204..1130
                     /gene="LOC106094391"
                     /note="Catalytic domain of the Serine/Threonine Kinase,
                     Cyclin-Dependent protein Kinase 10; Region: STKc_CDK10;
                     cd07845"
                     /db_xref="CDD:173742"
     misc_feature    order(246..257,270..272,309..311,315..317,366..368,
                     408..410,462..473,480..482,486..491,600..602,606..608,
                     612..617,621..623,654..656,663..665,699..701,705..716,
                     720..722,834..839)
                     /gene="LOC106094391"
                     /note="active site"
                     /db_xref="CDD:173742"
     misc_feature    order(246..257,270..272,309..311,315..317,408..410,
                     462..473,480..482,489..491,612..617,621..623,654..656)
                     /gene="LOC106094391"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173742"
     misc_feature    order(342..350,354..356,363..368,372..377,384..389,
                     423..425,429..431,450..452,567..569,576..587,669..671,
                     675..686,696..701,1038..1040,1050..1058)
                     /gene="LOC106094391"
                     /note="CDK/cyclin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173742"
     misc_feature    order(366..368,486..488,600..602,606..608,663..665,
                     699..701,705..716,720..722,834..839)
                     /gene="LOC106094391"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:173742"
     misc_feature    order(651..686,690..722)
                     /gene="LOC106094391"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173742"
     polyA_site      1346
                     /gene="LOC106094391"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaactgagtt tattatttta aacaagccaa attgaaagac tggaccacaa aagtgattgt
       61 agaaaaacta aaaccgatat ctgtattttc aatataaaat gagcaaaggc gatactgatc
      121 cagttgcgcc ggtaactcgt aaaggatttt tgatatccat taaaactggc gaaccaacag
      181 aaattagaga gcgtgatgtg catggccggt gtcgggctgt tactgagttt gagaaactta
      241 atcggattgg tgagggtaca tatggaattg tgtatcgtgc aagagatacc cgcactaatg
      301 agatagtggc tttgaaaaaa gttcgaatgg atcaagaaaa ggatggacta cccgtcagtg
      361 gattgcgaga aataacaatt ttgaaaaaat gcaaacatga aaatatagtc aacttacgag
      421 atgttgtcgt tggaaaaagt ttagaaagca tatttttggt gatggaatat tgcgaacaag
      481 acttagcatc gttattagat aacatggcac aaccattctc tgaatctgaa gtcaagtgta
      541 ttgtcctaca agttctacag ggactgaaat acatgcactc tcgttatatt atacatagag
      601 atttaaaagt ttcaaattta ttgatgaccg acaaaggatg tgtaaaaatt gccgattttg
      661 gattagcacg cctttttgga ttaccctcgg gacctatgac accgcaagta gttacattgt
      721 ggtatcgatc gcctgagtta ctgctgggat cacccactca aacaactgct gtcgatatgt
      781 gggccgtcgg ttgcatttta ggtgaacttc tatcacacaa accattgtta ccaggaaata
      841 ccgaaattgc tcaattggaa cttataattg acttattggg tactccatct gaagctatat
      901 ggccagatta tcccaaaatg ccggctatcc aaaattttac gcttaagaaa cagccgtaca
      961 acaacttaaa acctaaattt cagtatttat cggctgctgg attaaggcta ttaaatttcc
     1021 tatttatgta tgaccctaag aagagagcga cgcctgagga gtgtcttcac agcacatatt
     1081 tcaaagaacc accattacct tgtgacccca aattaatgcc tacattccct caacatcgaa
     1141 atatgcaaca caattctacg aaatctgcac caagtggagc ccatcacagt ggacctgtac
     1201 cggaattgcc tgctatttct gacttattgg gaagcctact taaaaaaaga agagtagact
     1261 aacagaattt ttctcacgaa tttttgtatc aaaaatgtat tgcatgaaaa aattaacata
     1321 ataaaatgca tttataaaac tagaaa