PREDICTED: Stomoxys calcitrans small ribosomal subunit protein eS28

LOCUS       XM_013261590             432 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094375), mRNA.
ACCESSION   XM_013261590
VERSION     XM_013261590.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261590.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..432
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..432
                     /gene="LOC106094375"
                     /note="small ribosomal subunit protein eS28; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 17 Proteins"
                     /db_xref="GeneID:106094375"
     CDS             85..282
                     /gene="LOC106094375"
                     /codon_start=1
                     /product="small ribosomal subunit protein eS28"
                     /protein_id="XP_013117044.1"
                     /db_xref="GeneID:106094375"
                     /translation="MDKPVVWARVIKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKG
                     PVREGDILTLLESEREARRLR"
     misc_feature    106..279
                     /gene="LOC106094375"
                     /note="S28E, S1-like RNA-binding domain. S1-like
                     RNA-binding domains are found in a wide variety of
                     RNA-associated proteins. S28E protein is a component of
                     the 30S ribosomal subunit. S28E is highly conserved among
                     archaea and eukaryotes. S28E may control...; Region:
                     S1_S28E; cd04457"
                     /db_xref="CDD:239904"
     misc_feature    order(115..117,163..165,199..201,205..207)
                     /gene="LOC106094375"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239904"
     polyA_site      432
                     /gene="LOC106094375"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctttcttttc gtttccggct gtcactttgt gtgtgtgtcg cacgtgaatt ttttaataga
       61 aaaatcacaa tttattaaca aaatatggat aaacctgttg tttgggcacg tgttatcaaa
      121 gtcttgggcc gcactggctc ccagggtcaa tgtacccaag tcaaagtgga gttccttggt
      181 gaacaaaacc gtcaaatcat ccgcaacgtt aagggaccag ttcgtgaagg cgatatcttg
      241 acattgttgg aatctgaacg tgaagccaga agacttcgct gaaagaggag ctgtgttcaa
      301 agctggaggg aggataatga cacattggaa atcttttttt tactgtaatg tgatgtacat
      361 ttaacaacat gaaggtttta gtgatgacat caataaaaag cctctggaaa gttttgaaga
      421 tttaagacaa aa