Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mitochondrial import inner membrane


LOCUS       XM_013261580             780 bp    mRNA    linear   INV 02-SEP-2023
            translocase subunit Tim29 (LOC106094365), mRNA.
ACCESSION   XM_013261580
VERSION     XM_013261580.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261580.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..780
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..780
                     /gene="LOC106094365"
                     /note="mitochondrial import inner membrane translocase
                     subunit Tim29; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:106094365"
     CDS             185..760
                     /gene="LOC106094365"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim29"
                     /protein_id="XP_013117034.1"
                     /db_xref="GeneID:106094365"
                     /translation="MRFFSFSNRLASLRARVDNTFTLPERFKGTFVERLTNYWKGLLT
                     DYKDVAVGIVKESIEKPKKAIFYGVTGYSIYLCGQRNPSEEDFIRQFRLATNEMILVN
                     PSLQNPTSDAYLRRLQEDINQRRLRFLSLGILTLMWEDLYDSDDCTYPAICEYTKVSF
                     WSIPQHVIDVGFWNKFWRLKYELHNYDVNYL"
     misc_feature    266..754
                     /gene="LOC106094365"
                     /note="Translocase of the Inner Mitochondrial membrane 29;
                     Region: Tim29; pfam10171"
                     /db_xref="CDD:462977"
     polyA_site      780
                     /gene="LOC106094365"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttactctc ctgcaaattt ttactggaaa agtacgcgaa cagacctata atgtttccag
       61 gtgtcattat cagctggcac aatgtgccaa aatcgattag ctactacggc ctgtaaaaag
      121 ttgaataata agaaatacat ttatgaatta gattaaaaac cttaacgaaa aaatttcctg
      181 caaaatgcgt ttcttctctt tttccaaccg actggcgagt ctacgtgcaa gagtagacaa
      241 tacatttaca ttgcccgaac gctttaaagg cacctttgtg gagagactta caaactactg
      301 gaaaggcctt ttaactgact ataaagatgt tgccgtggga attgtgaaag aaagtataga
      361 gaaaccaaag aaggcgatat tctatggagt gacaggatat tctatatatt tgtgcggcca
      421 acgaaacccc agtgaagaag attttattcg tcaatttcgt ttggctacaa atgagatgat
      481 actggtaaac ccttcactgc agaacccaac ttcagatgca tatttaagac gactgcaaga
      541 ggatattaat cagagacgtt tacgtttctt atcacttggt atattgactt taatgtggga
      601 ggatttatac gacagcgatg attgcacata tccggcaata tgcgaatata ccaaagtgtc
      661 attttggtcc ataccacaac atgtgattga tgtcggattc tggaataaat tttggcgttt
      721 aaaatatgaa ttgcacaact acgatgtaaa ttatttgtaa taaaatacga agacaatttg