Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261580 780 bp mRNA linear INV 02-SEP-2023 translocase subunit Tim29 (LOC106094365), mRNA. ACCESSION XM_013261580 VERSION XM_013261580.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261580.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..780 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..780 /gene="LOC106094365" /note="mitochondrial import inner membrane translocase subunit Tim29; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106094365" CDS 185..760 /gene="LOC106094365" /codon_start=1 /product="mitochondrial import inner membrane translocase subunit Tim29" /protein_id="XP_013117034.1" /db_xref="GeneID:106094365" /translation="MRFFSFSNRLASLRARVDNTFTLPERFKGTFVERLTNYWKGLLT DYKDVAVGIVKESIEKPKKAIFYGVTGYSIYLCGQRNPSEEDFIRQFRLATNEMILVN PSLQNPTSDAYLRRLQEDINQRRLRFLSLGILTLMWEDLYDSDDCTYPAICEYTKVSF WSIPQHVIDVGFWNKFWRLKYELHNYDVNYL" misc_feature 266..754 /gene="LOC106094365" /note="Translocase of the Inner Mitochondrial membrane 29; Region: Tim29; pfam10171" /db_xref="CDD:462977" polyA_site 780 /gene="LOC106094365" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttactctc ctgcaaattt ttactggaaa agtacgcgaa cagacctata atgtttccag 61 gtgtcattat cagctggcac aatgtgccaa aatcgattag ctactacggc ctgtaaaaag 121 ttgaataata agaaatacat ttatgaatta gattaaaaac cttaacgaaa aaatttcctg 181 caaaatgcgt ttcttctctt tttccaaccg actggcgagt ctacgtgcaa gagtagacaa 241 tacatttaca ttgcccgaac gctttaaagg cacctttgtg gagagactta caaactactg 301 gaaaggcctt ttaactgact ataaagatgt tgccgtggga attgtgaaag aaagtataga 361 gaaaccaaag aaggcgatat tctatggagt gacaggatat tctatatatt tgtgcggcca 421 acgaaacccc agtgaagaag attttattcg tcaatttcgt ttggctacaa atgagatgat 481 actggtaaac ccttcactgc agaacccaac ttcagatgca tatttaagac gactgcaaga 541 ggatattaat cagagacgtt tacgtttctt atcacttggt atattgactt taatgtggga 601 ggatttatac gacagcgatg attgcacata tccggcaata tgcgaatata ccaaagtgtc 661 attttggtcc ataccacaac atgtgattga tgtcggattc tggaataaat tttggcgttt 721 aaaatatgaa ttgcacaact acgatgtaaa ttatttgtaa taaaatacga agacaatttg