Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261320 494 bp mRNA linear INV 02-SEP-2023 (LOC106094132), mRNA. ACCESSION XM_013261320 VERSION XM_013261320.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261320.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..494 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..494 /gene="LOC106094132" /note="uncharacterized LOC106094132; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106094132" CDS 99..419 /gene="LOC106094132" /codon_start=1 /product="uncharacterized protein LOC106094132" /protein_id="XP_013116774.1" /db_xref="GeneID:106094132" /translation="MRLTLIQLFKDTVPGHIFRGKRRLVKPVSLRAMETLRREYERED KIMLLLRHPYLTVEESAGHVKDLKKSEAKIAMWNDAKTAKKMKPHVTLEDRLMHLKVK EAWD" misc_feature 138..413 /gene="LOC106094132" /note="Mitochondrial ribosome protein 63; Region: MRP-63; pfam14978" /db_xref="CDD:434363" polyA_site 494 /gene="LOC106094132" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atcagctgtc agttgtgtgg taattgtcat ataccaacca ttcattattt aaccaattta 61 cttaaaacat cggattcttt aattgaaagt taaacaaaat gcgtcttact ctgatacaac 121 tcttcaaaga taccgtacct ggacatattt ttcggggcaa acgtcgtttg gtcaagccag 181 taagcctcag ggccatggaa acactgcgtc gagagtatga gagggaggac aaaattatgt 241 tgcttttaag acatccctat ctgacagtgg aagaatctgc aggacacgtg aaagatctca 301 agaagtcaga ggcaaaaata gctatgtgga atgatgcaaa aactgcaaag aaaatgaaac 361 cccatgtaac tctggaagat cgattgatgc atttaaaagt gaaggaggca tgggattaga 421 tataggaata taaaagctgc tgtttacgtt gtttcgttta ttggaataag taataaaaat 481 tatatttttg gtta