Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094132


LOCUS       XM_013261320             494 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094132), mRNA.
ACCESSION   XM_013261320
VERSION     XM_013261320.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261320.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..494
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..494
                     /gene="LOC106094132"
                     /note="uncharacterized LOC106094132; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106094132"
     CDS             99..419
                     /gene="LOC106094132"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094132"
                     /protein_id="XP_013116774.1"
                     /db_xref="GeneID:106094132"
                     /translation="MRLTLIQLFKDTVPGHIFRGKRRLVKPVSLRAMETLRREYERED
                     KIMLLLRHPYLTVEESAGHVKDLKKSEAKIAMWNDAKTAKKMKPHVTLEDRLMHLKVK
                     EAWD"
     misc_feature    138..413
                     /gene="LOC106094132"
                     /note="Mitochondrial ribosome protein 63; Region: MRP-63;
                     pfam14978"
                     /db_xref="CDD:434363"
     polyA_site      494
                     /gene="LOC106094132"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atcagctgtc agttgtgtgg taattgtcat ataccaacca ttcattattt aaccaattta
       61 cttaaaacat cggattcttt aattgaaagt taaacaaaat gcgtcttact ctgatacaac
      121 tcttcaaaga taccgtacct ggacatattt ttcggggcaa acgtcgtttg gtcaagccag
      181 taagcctcag ggccatggaa acactgcgtc gagagtatga gagggaggac aaaattatgt
      241 tgcttttaag acatccctat ctgacagtgg aagaatctgc aggacacgtg aaagatctca
      301 agaagtcaga ggcaaaaata gctatgtgga atgatgcaaa aactgcaaag aaaatgaaac
      361 cccatgtaac tctggaagat cgattgatgc atttaaaagt gaaggaggca tgggattaga
      421 tataggaata taaaagctgc tgtttacgtt gtttcgttta ttggaataag taataaaaat
      481 tatatttttg gtta