Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DNA polymerase epsilon subunit 3


LOCUS       XM_013261319             585 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094131), mRNA.
ACCESSION   XM_013261319
VERSION     XM_013261319.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013261319.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..585
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..585
                     /gene="LOC106094131"
                     /note="DNA polymerase epsilon subunit 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106094131"
     CDS             135..491
                     /gene="LOC106094131"
                     /codon_start=1
                     /product="DNA polymerase epsilon subunit 3"
                     /protein_id="XP_013116773.1"
                     /db_xref="GeneID:106094131"
                     /translation="MVERIEDLNLPNAVISRLLKEALPDGANVSKEARAAIARAASVF
                     VIFLTSTSTSLARKQNHKTITASNILDALKQLEFESFVDPLTKDLDAYRKVVKDKKDK
                     AKKDSAVAENGDKDAA"
     misc_feature    150..410
                     /gene="LOC106094131"
                     /note="histone-fold domain found in DNA polymerase epsilon
                     subunit 3 (POLE3) and similar proteins; Region:
                     HFD_POLE3_DPB4; cd22928"
                     /db_xref="CDD:467053"
     misc_feature    order(150..155,249..251,261..263,270..275,282..287,
                     330..335,357..359,372..374,390..395,402..404)
                     /gene="LOC106094131"
                     /note="catalytic subunit binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467053"
     misc_feature    order(174..176,186..191,195..197,219..224,228..233,
                     240..245,249..257,261..281,318..332,339..341,360..368,
                     375..377,384..389,396..401,405..410)
                     /gene="LOC106094131"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467053"
     polyA_site      585
                     /gene="LOC106094131"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacaaacaaa tcgactgcga cctatcgact tttttacaca taaattccga ttagtccgcc
       61 aaatttcagt aatttgcaat acaagctaca aacatcattt taaatttcct ctttaatatt
      121 atacgattgc aattatggtc gaaagaattg aagatctgaa tttgcccaac gctgttatat
      181 cacgacttct caaagaggcc ttgcccgatg gagccaatgt ttccaaagag gctagggcag
      241 ccattgcaag agccgcatcc gtttttgtta tattcctgac atccacctca acatcattgg
      301 cccgcaaaca aaatcacaaa accataactg cctcaaacat attggatgct ctgaaacaat
      361 tggagtttga gagttttgtt gatccgctga ccaaagattt agatgcctat cgaaaagtgg
      421 taaaagacaa gaaggacaaa gcaaagaaag acagcgcagt ggcagagaat ggcgataagg
      481 atgcggcgta gctatagact gaaattggat tgtaatttgt tataattaaa tttaaacttt
      541 tatggagatt actaataaaa gagctaaaat gcataagtaa acgaa