Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013261319 585 bp mRNA linear INV 02-SEP-2023 (LOC106094131), mRNA. ACCESSION XM_013261319 VERSION XM_013261319.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013261319.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..585 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..585 /gene="LOC106094131" /note="DNA polymerase epsilon subunit 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106094131" CDS 135..491 /gene="LOC106094131" /codon_start=1 /product="DNA polymerase epsilon subunit 3" /protein_id="XP_013116773.1" /db_xref="GeneID:106094131" /translation="MVERIEDLNLPNAVISRLLKEALPDGANVSKEARAAIARAASVF VIFLTSTSTSLARKQNHKTITASNILDALKQLEFESFVDPLTKDLDAYRKVVKDKKDK AKKDSAVAENGDKDAA" misc_feature 150..410 /gene="LOC106094131" /note="histone-fold domain found in DNA polymerase epsilon subunit 3 (POLE3) and similar proteins; Region: HFD_POLE3_DPB4; cd22928" /db_xref="CDD:467053" misc_feature order(150..155,249..251,261..263,270..275,282..287, 330..335,357..359,372..374,390..395,402..404) /gene="LOC106094131" /note="catalytic subunit binding site [polypeptide binding]; other site" /db_xref="CDD:467053" misc_feature order(174..176,186..191,195..197,219..224,228..233, 240..245,249..257,261..281,318..332,339..341,360..368, 375..377,384..389,396..401,405..410) /gene="LOC106094131" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:467053" polyA_site 585 /gene="LOC106094131" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aacaaacaaa tcgactgcga cctatcgact tttttacaca taaattccga ttagtccgcc 61 aaatttcagt aatttgcaat acaagctaca aacatcattt taaatttcct ctttaatatt 121 atacgattgc aattatggtc gaaagaattg aagatctgaa tttgcccaac gctgttatat 181 cacgacttct caaagaggcc ttgcccgatg gagccaatgt ttccaaagag gctagggcag 241 ccattgcaag agccgcatcc gtttttgtta tattcctgac atccacctca acatcattgg 301 cccgcaaaca aaatcacaaa accataactg cctcaaacat attggatgct ctgaaacaat 361 tggagtttga gagttttgtt gatccgctga ccaaagattt agatgcctat cgaaaagtgg 421 taaaagacaa gaaggacaaa gcaaagaaag acagcgcagt ggcagagaat ggcgataagg 481 atgcggcgta gctatagact gaaattggat tgtaatttgt tataattaaa tttaaacttt 541 tatggagatt actaataaaa gagctaaaat gcataagtaa acgaa