Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093663


LOCUS       XM_013260777             804 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093663), mRNA.
ACCESSION   XM_013260777
VERSION     XM_013260777.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260777.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..804
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..804
                     /gene="LOC106093663"
                     /note="uncharacterized LOC106093663; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106093663"
     CDS             1..618
                     /gene="LOC106093663"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093663"
                     /protein_id="XP_013116231.2"
                     /db_xref="GeneID:106093663"
                     /translation="MTTRTLANISIICFLSGYSILHVESASINASPDNVVYRLFHRRR
                     PGLNYEGVEVEVDEYLEIFNTRKRPWDILTDDDVDKFIKCDFYGETEECTQFLSSIYP
                     NESGTHGKPITTTKKKTITATTPSKAINTIHTTTTPSTSSTTTMEPIPDPDWNSYIEG
                     DGEEVGDEEEEENYISEENGEDIELAEHEEKENVNNQKEKPFFFF"
     polyA_site      804
                     /gene="LOC106093663"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgaccacaa gaactttagc aaacatttca attatttgtt tcttaagtgg ttatagtatt
       61 cttcatgtag aatcggcatc tataaatgcg tcgcctgata atgtggtcta tcggctcttt
      121 cacaggcgca gacctggtct taactacgaa ggagtagaag tagaagtcga cgaatatttg
      181 gaaattttta ataccagaaa aagaccatgg gatattttga ctgatgatga tgtggataaa
      241 tttattaaat gtgattttta tggtgaaacc gaagaatgta cacaattttt aagctccata
      301 tatcccaatg aatcaggaac acatggaaaa ccaataacaa caactaaaaa gaaaacgatt
      361 accgcaacca ctccatccaa agcaattaat accatccata ctactactac tccttccact
      421 agttcgacaa caacaatgga accaataccc gatcctgatt ggaattctta tatagaagga
      481 gatggtgaag aagtaggaga tgaagaagaa gaagaaaatt acatcagcga ggaaaatgga
      541 gaagacattg aactagcgga acacgaagag aaagagaatg taaacaacca aaaggagaaa
      601 ccattctttt tcttctagcg aaacacgaag ggaaagagaa tggaaacaac caaaaggaga
      661 aacctttctt tttcttcaag tagtttttgt taaaatcgta tcgtaaatcg catgcatgaa
      721 aataatttta tcttaatttt ttattatctt tattgttatt ttacttttac aatttcttaa
      781 taaacgcata tatatctata tata