PREDICTED: Stomoxys calcitrans keratin-associated protein 21-1-like

LOCUS       XM_013260663             534 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093589), mRNA.
ACCESSION   XM_013260663
VERSION     XM_013260663.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260663.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 12% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..534
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..534
                     /gene="LOC106093589"
                     /note="keratin-associated protein 21-1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:106093589"
     CDS             1..534
                     /gene="LOC106093589"
                     /codon_start=1
                     /product="keratin-associated protein 21-1-like"
                     /protein_id="XP_013116117.2"
                     /db_xref="GeneID:106093589"
                     /translation="MKAYVCVIALIALLAPTQATFDKLGLLAGGSLGYGNVYNGGYGG
                     GYGIGYGGGYGGGYGGYRYGSGYGGGYGSNVKVVKVTVVPSGGGYGGGYGGGYGGGYG
                     GGYGGGYGGSYGGGYGVTPVATVATPVITAVSTPVVSGYGGFYGAGSYGYGYGSNVIP
                     SYGGGVGLGYGAAADCF"
ORIGIN      
        1 atgaaagcct acgtgtgtgt gattgcattg attgccctgc tggctcccac tcaagccaca
       61 tttgacaagc tgggtttatt ggctggaggc tcactgggtt atggaaatgt ctataacggt
      121 ggctatggcg gaggatatgg cattggttat ggtggaggat atggtggcgg ctatggagga
      181 tacagatacg gtagcggtta tggcggcgga tatggcagta acgttaaagt tgtcaaagtc
      241 actgtggttc ccagcggtgg cggctatggc ggtggctatg gaggtggtta tggcggtggc
      301 tacggtggtg gctacggtgg tggctacggt ggtagctacg gtggtggcta cggtgtaacc
      361 cccgttgcca ctgtagctac tccagtcata actgccgtct caacacctgt tgtttctgga
      421 tatggaggct tctatggcgc aggctcttac ggatacggtt atggcagcaa tgttattcct
      481 tcttatggag gtggtgtagg tttaggttac ggagcagctg ctgactgctt ctaa