Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260556 836 bp mRNA linear INV 02-SEP-2023 (LOC106093493), mRNA. ACCESSION XM_013260556 VERSION XM_013260556.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260556.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 43% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..836 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..836 /gene="LOC106093493" /note="keratin, type I cytoskeletal 9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106093493" CDS 1..762 /gene="LOC106093493" /codon_start=1 /product="keratin, type I cytoskeletal 9" /protein_id="XP_013116010.2" /db_xref="GeneID:106093493" /translation="MKVFICVLAMVSAAKAGILGIAAGSGGYGGGHSSGGGGYIYNNG GYSSGGSGYSSGSSAASVVKVIHEGGGDHGGFSSGSLSGGYGSSHGASFHDSGFSGGF DAGHTGAFGGSGGHAISGDVKIIKVISHASGSGSGYGGGSYGGISGGHGGFSGGHGGI VKILKVIHEDGGFSGGHSGGFSDYHSGGFSSGGHLDSYSSGHAGGYSGGHSGGDVKIL KIISQGGSGGTSHGVVSAGYGGGASGWSSVGSGGW" ORIGIN 1 atgaaggttt tcatttgcgt cttggcaatg gtgtctgcag ccaaagctgg aatcttgggc 61 atcgctgctg gatccggtgg ctacggtggt ggtcatagta gtggaggagg cggctatatt 121 tataacaatg ggggctacag ttccggtggc agtggctatt cttccggtag cagtgccgct 181 agtgttgtaa aagtgatcca tgaaggtggc ggtgatcatg gtggattctc ctctggcagt 241 ctgagtggtg gctatggaag cagccatggt gccagtttcc acgatagtgg ttttagtggt 301 ggttttgatg ctggacacac tggagccttt ggtggaagtg gtggccatgc catctctggt 361 gatgtgaaaa tcataaaagt gatatcccat gcatcaggtt cgggctcggg atacggaggc 421 ggcagttatg gcggaatttc tggtggtcat ggcggtttct ccggcggcca tggaggcatt 481 gtgaaaatcc taaaagttat ccacgaagat ggtggtttct ccggcggcca ttcaggagga 541 ttttccgatt atcattccgg cggtttctca tctggtggtc atttggatag ctactcctct 601 ggccatgccg gtggttattc aggaggccat tctggtggcg atgtaaagat tttaaagatt 661 ataagccaag gtggaagtgg aggtactagt catggtgttg tgtcagctgg ttatggaggt 721 ggtgcaagcg gttggtcctc tgtaggcagt ggtggttggt aaatgttgta cttgcaagta 781 gatatttttt agtattactt ctctcatctc agctatttat cttcattctt ttgtaa