Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans keratin, type I cytoskeletal 9


LOCUS       XM_013260556             836 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093493), mRNA.
ACCESSION   XM_013260556
VERSION     XM_013260556.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260556.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 43% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..836
                     /gene="LOC106093493"
                     /note="keratin, type I cytoskeletal 9; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106093493"
     CDS             1..762
                     /gene="LOC106093493"
                     /codon_start=1
                     /product="keratin, type I cytoskeletal 9"
                     /protein_id="XP_013116010.2"
                     /db_xref="GeneID:106093493"
                     /translation="MKVFICVLAMVSAAKAGILGIAAGSGGYGGGHSSGGGGYIYNNG
                     GYSSGGSGYSSGSSAASVVKVIHEGGGDHGGFSSGSLSGGYGSSHGASFHDSGFSGGF
                     DAGHTGAFGGSGGHAISGDVKIIKVISHASGSGSGYGGGSYGGISGGHGGFSGGHGGI
                     VKILKVIHEDGGFSGGHSGGFSDYHSGGFSSGGHLDSYSSGHAGGYSGGHSGGDVKIL
                     KIISQGGSGGTSHGVVSAGYGGGASGWSSVGSGGW"
ORIGIN      
        1 atgaaggttt tcatttgcgt cttggcaatg gtgtctgcag ccaaagctgg aatcttgggc
       61 atcgctgctg gatccggtgg ctacggtggt ggtcatagta gtggaggagg cggctatatt
      121 tataacaatg ggggctacag ttccggtggc agtggctatt cttccggtag cagtgccgct
      181 agtgttgtaa aagtgatcca tgaaggtggc ggtgatcatg gtggattctc ctctggcagt
      241 ctgagtggtg gctatggaag cagccatggt gccagtttcc acgatagtgg ttttagtggt
      301 ggttttgatg ctggacacac tggagccttt ggtggaagtg gtggccatgc catctctggt
      361 gatgtgaaaa tcataaaagt gatatcccat gcatcaggtt cgggctcggg atacggaggc
      421 ggcagttatg gcggaatttc tggtggtcat ggcggtttct ccggcggcca tggaggcatt
      481 gtgaaaatcc taaaagttat ccacgaagat ggtggtttct ccggcggcca ttcaggagga
      541 ttttccgatt atcattccgg cggtttctca tctggtggtc atttggatag ctactcctct
      601 ggccatgccg gtggttattc aggaggccat tctggtggcg atgtaaagat tttaaagatt
      661 ataagccaag gtggaagtgg aggtactagt catggtgttg tgtcagctgg ttatggaggt
      721 ggtgcaagcg gttggtcctc tgtaggcagt ggtggttggt aaatgttgta cttgcaagta
      781 gatatttttt agtattactt ctctcatctc agctatttat cttcattctt ttgtaa