Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260445 648 bp mRNA linear INV 02-SEP-2023 (LOC106093391), mRNA. ACCESSION XM_013260445 VERSION XM_013260445.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260445.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..648 /gene="LOC106093391" /note="uncharacterized LOC106093391; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106093391" CDS 1..393 /gene="LOC106093391" /codon_start=1 /product="uncharacterized protein LOC106093391" /protein_id="XP_013115899.2" /db_xref="GeneID:106093391" /translation="MPAKSNNSSSLEPTTTTVTTPSPTPSIATQSQLPERSHSIESHH SKAKAKFLQPKQEYPTSSLNSRHFTLKRQKRISENRPIPMKKRTSSMRKSRSLDADRA YSLSSIQSPLWVTLTNARTIEELSREQI" ORIGIN 1 atgcctgcca aatcaaacaa ttcctccagt ttggagccca ccaccacaac ggtcaccact 61 ccatctccca caccatcaat tgcaactcaa tcccagctac cagagcgttc ccattcaata 121 gagtcccatc actcaaaagc caaagctaaa tttcttcaac ccaaacagga ataccccaca 181 tcctcgctca attctcgcca ttttactttg aaacgccaaa agaggatatc ggaaaatcgt 241 ccaataccca tgaaaaaacg tacatcctct atgagaaaat ctcgctctct agatgccgat 301 cgagcctatt ctttatccag cattcaatca ccgctgtggg ttaccctaac caatgctcgc 361 accatagaag aactttcgag ggagcaaatc tagttggtcg aaattccaca aaatgtagct 421 ttcaattgaa ttaatgtgta gtctgtgtga gccgcagcat tagcaaaagc aactgtaagg 481 aatacattga aatattattt taatttttca aacaacaatt tttcgtaaac gcaatacaaa 541 aatcaaacga gtttcataag caacaaagcc tcttttcaat ttgtattata tgtctgttta 601 taaatatttg tctgtagaga gaaaaacata cgaactaaat aataaaat