Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093391


LOCUS       XM_013260445             648 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093391), mRNA.
ACCESSION   XM_013260445
VERSION     XM_013260445.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260445.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..648
                     /gene="LOC106093391"
                     /note="uncharacterized LOC106093391; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106093391"
     CDS             1..393
                     /gene="LOC106093391"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093391"
                     /protein_id="XP_013115899.2"
                     /db_xref="GeneID:106093391"
                     /translation="MPAKSNNSSSLEPTTTTVTTPSPTPSIATQSQLPERSHSIESHH
                     SKAKAKFLQPKQEYPTSSLNSRHFTLKRQKRISENRPIPMKKRTSSMRKSRSLDADRA
                     YSLSSIQSPLWVTLTNARTIEELSREQI"
ORIGIN      
        1 atgcctgcca aatcaaacaa ttcctccagt ttggagccca ccaccacaac ggtcaccact
       61 ccatctccca caccatcaat tgcaactcaa tcccagctac cagagcgttc ccattcaata
      121 gagtcccatc actcaaaagc caaagctaaa tttcttcaac ccaaacagga ataccccaca
      181 tcctcgctca attctcgcca ttttactttg aaacgccaaa agaggatatc ggaaaatcgt
      241 ccaataccca tgaaaaaacg tacatcctct atgagaaaat ctcgctctct agatgccgat
      301 cgagcctatt ctttatccag cattcaatca ccgctgtggg ttaccctaac caatgctcgc
      361 accatagaag aactttcgag ggagcaaatc tagttggtcg aaattccaca aaatgtagct
      421 ttcaattgaa ttaatgtgta gtctgtgtga gccgcagcat tagcaaaagc aactgtaagg
      481 aatacattga aatattattt taatttttca aacaacaatt tttcgtaaac gcaatacaaa
      541 aatcaaacga gtttcataag caacaaagcc tcttttcaat ttgtattata tgtctgttta
      601 taaatatttg tctgtagaga gaaaaacata cgaactaaat aataaaat