Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ubiquitin-conjugating enzyme E2 G2


LOCUS       XM_013260400            1243 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093352), transcript variant X3, mRNA.
ACCESSION   XM_013260400
VERSION     XM_013260400.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260400.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1243
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1243
                     /gene="LOC106093352"
                     /note="ubiquitin-conjugating enzyme E2 G2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 31 Proteins"
                     /db_xref="GeneID:106093352"
     CDS             386..889
                     /gene="LOC106093352"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 G2"
                     /protein_id="XP_013115854.1"
                     /db_xref="GeneID:106093352"
                     /translation="MAGSALRRLMAECKQLTLDPPDGIVAGPVSEDNFFEWEALIAGP
                     EGTCFEGGVFPARLVFPPDYPLSPPKMKFTCEMFHPNIFADGRVCISILHAPGDDPMG
                     YESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDAAIMWREKREEFNKIAKRLVR
                     KTLGLPS"
     misc_feature    401..874
                     /gene="LOC106093352"
                     /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc)
                     domain of ubiquitin-conjugating enzyme E2 G2 and related
                     proteins; Region: UBCc_UBE2G2; cd23796"
                     /db_xref="CDD:467416"
     polyA_site      1243
                     /gene="LOC106093352"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acgtttttat ttagatctgt ttttgcccct atacttgaag aaagaaaaat ttattttccc
       61 cagaacattc tccattatcg taaaaaatac aaagcaaaat taaataaaaa ttaccaatat
      121 cagcacaaca catcaaaatt aaagcagaca ggcacacaca tcacatctca cacggtcgct
      181 gcagcagcgc agctacttaa tcgtagagac gtctcatacc ataaataagg aacaataacg
      241 acgtaacaac gaaaagaaac aacagagcaa gcagccagct gaagcaaatg taaaattgta
      301 aatttcccgc aaaagtagag aaagtgcaag gaaaataaca agtggtgacc gaaaggatag
      361 agagtcaacc cacagaaaca taaacatggc aggttcagca cttagaagac ttatggcaga
      421 atgcaaacaa ctgactttgg acccaccaga tggcatagtg gcagggccag taagcgaaga
      481 taacttcttt gaatgggaag cgttgatagc tggtcccgag ggcacatgct tcgagggtgg
      541 cgtcttccca gcccgtttag tattcccacc cgactacccg cttagtccgc caaaaatgaa
      601 attcacctgt gaaatgtttc atccgaatat ttttgctgat ggacgtgttt gcatatcaat
      661 attacatgcc cccggcgatg atcccatggg ctatgaatca tccgccgaac gctggagtcc
      721 tgtgcaaagt gtggagaaga tattactcag tgtcgtatca atgttagctg aacccaacga
      781 tgagtctgga gccaatgttg atgcggctat aatgtggcgc gaaaaacgtg aggagtttaa
      841 taaaatcgcc aaacgtttgg tgcgtaaaac cctgggtttg ccctcataaa taaacatacc
      901 acaaaatttt agaaatatgc aaaacgattt aaaacaaaat gtaactagag aaacatcatt
      961 gatttatata tacaaaaaaa aaactaaaaa aaaatatata gtaatagaaa tgtacgtagg
     1021 tttgtatcag ctacagacct ttaaatgata aaatcaccat tgtaacaaaa aaaaaaaaat
     1081 agaaacttta gttaaaaaca aaacaaaatc tgtaatacta atctaaacga taattttgtg
     1141 ttcccaaaca ccaaaaggat ttcacagtaa acataaattt gattacaaaa aacaaaacac
     1201 aaaaaaaatg aataaaacaa aagaaaatat gatttctcaa ata