Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans large ribosomal subunit protein P2


LOCUS       XM_013260385             780 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093337), mRNA.
ACCESSION   XM_013260385
VERSION     XM_013260385.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..780
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..780
                     /gene="LOC106093337"
                     /note="large ribosomal subunit protein P2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 35 Proteins"
                     /db_xref="GeneID:106093337"
     CDS             113..454
                     /gene="LOC106093337"
                     /codon_start=1
                     /product="large ribosomal subunit protein P2"
                     /protein_id="XP_013115839.1"
                     /db_xref="GeneID:106093337"
                     /translation="MRYVAAYMLAVLGGLENPKNADIEKILSSVGIEADNERLTKVVK
                     ELNGKSVEELIASGREKLSSMPVGGGAAAAPAAAGGADAGGKKEEAKKEEKKVESESE
                     EDDDMGFALFD"
     misc_feature    113..451
                     /gene="LOC106093337"
                     /note="Ribosomal protein P2. This subfamily represents the
                     eukaryotic large ribosomal protein P2. Eukaryotic P1 and
                     P2 are functionally equivalent to the bacterial protein
                     L7/L12, but are not homologous to L7/L12. P2 is located in
                     the L12 stalk, with proteins...; Region: Ribosomal_P2;
                     cd05833"
                     /db_xref="CDD:100111"
     polyA_site      780
                     /gene="LOC106093337"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacctccaaa tgtcatctag ctgagtaaat tcttttcgtt ctgaagtttt taaacgaaag
       61 ttgttttttc ttgtgctgta cacgtttcgt gtcaataaca aaggcttaaa aaatgcgtta
      121 cgtggctgca tatatgttgg ctgttctcgg cggtttggaa aaccccaaaa atgctgatat
      181 tgaaaagatc ctcagctctg ttggtattga agctgacaac gaacgcttga ccaaagtagt
      241 taaggaattg aacggcaagt ctgtcgaaga attgatcgcc tctggccgcg agaaattgtc
      301 ttccatgcct gttggtggtg gtgccgccgc tgctcctgct gctgctggtg gtgctgatgc
      361 cggtggtaag aaagaggaag ccaagaagga agaaaagaag gtcgaatccg aatctgaaga
      421 agatgacgat atgggctttg ctcttttcga ttaaattcac ttgggaatag tcataacaca
      481 agttcaaaac aacagtaaca gcaaggcaac aacaacaact atggtcatta gcgtgaaaaa
      541 acttgtcgag cttttttaac caaaaacatt tcctcagtcg tagcagccat cattatacag
      601 ccggtttata gaaaaaataa tcagggactt tcttataaaa ccccacaggt tttataagaa
      661 ttttcttttt tgacaaaatt atttgacatt aaaccagtac aaaaaagatt gaggttttta
      721 tttctatgaa ataaaacttt tacaagtttt tacacgttaa agaaaaaatg caaatgcaaa