Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260385 780 bp mRNA linear INV 02-SEP-2023 (LOC106093337), mRNA. ACCESSION XM_013260385 VERSION XM_013260385.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..780 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..780 /gene="LOC106093337" /note="large ribosomal subunit protein P2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 35 Proteins" /db_xref="GeneID:106093337" CDS 113..454 /gene="LOC106093337" /codon_start=1 /product="large ribosomal subunit protein P2" /protein_id="XP_013115839.1" /db_xref="GeneID:106093337" /translation="MRYVAAYMLAVLGGLENPKNADIEKILSSVGIEADNERLTKVVK ELNGKSVEELIASGREKLSSMPVGGGAAAAPAAAGGADAGGKKEEAKKEEKKVESESE EDDDMGFALFD" misc_feature 113..451 /gene="LOC106093337" /note="Ribosomal protein P2. This subfamily represents the eukaryotic large ribosomal protein P2. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P2 is located in the L12 stalk, with proteins...; Region: Ribosomal_P2; cd05833" /db_xref="CDD:100111" polyA_site 780 /gene="LOC106093337" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tacctccaaa tgtcatctag ctgagtaaat tcttttcgtt ctgaagtttt taaacgaaag 61 ttgttttttc ttgtgctgta cacgtttcgt gtcaataaca aaggcttaaa aaatgcgtta 121 cgtggctgca tatatgttgg ctgttctcgg cggtttggaa aaccccaaaa atgctgatat 181 tgaaaagatc ctcagctctg ttggtattga agctgacaac gaacgcttga ccaaagtagt 241 taaggaattg aacggcaagt ctgtcgaaga attgatcgcc tctggccgcg agaaattgtc 301 ttccatgcct gttggtggtg gtgccgccgc tgctcctgct gctgctggtg gtgctgatgc 361 cggtggtaag aaagaggaag ccaagaagga agaaaagaag gtcgaatccg aatctgaaga 421 agatgacgat atgggctttg ctcttttcga ttaaattcac ttgggaatag tcataacaca 481 agttcaaaac aacagtaaca gcaaggcaac aacaacaact atggtcatta gcgtgaaaaa 541 acttgtcgag cttttttaac caaaaacatt tcctcagtcg tagcagccat cattatacag 601 ccggtttata gaaaaaataa tcagggactt tcttataaaa ccccacaggt tttataagaa 661 ttttcttttt tgacaaaatt atttgacatt aaaccagtac aaaaaagatt gaggttttta 721 tttctatgaa ataaaacttt tacaagtttt tacacgttaa agaaaaaatg caaatgcaaa