Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093299


LOCUS       XM_013260349            1214 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093299), mRNA.
ACCESSION   XM_013260349
VERSION     XM_013260349.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260349.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1214
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1214
                     /gene="LOC106093299"
                     /note="uncharacterized LOC106093299; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106093299"
     CDS             148..1053
                     /gene="LOC106093299"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093299"
                     /protein_id="XP_013115803.1"
                     /db_xref="GeneID:106093299"
                     /translation="MSNKNYIANLSYVQKRDFLNSFDLVFCDCDGVIWHNLFDPIPGA
                     SDAIAYLRAKGKQVVFVTNNSIMSTADQLKKFSKCNIIVKEHELIHPAKTISNYLKNL
                     GFEGLILCFASSIFKQHLRENGFEVVEEKERLIDGSVLDLRNAIYNKDPIKAVIIDID
                     FNLTAWKLMRAQVHLKNPECLFIAGAADPRIPFGGNELLGPGAYIRLVEEANQRKAKV
                     FGKPGAELGELLKVMFNIKDPQRVLMVGDSLKSDIIFGKNCGFQTLFVLAGNMEQSEF
                     EALQLNKMDRPDFVIEKLSDLSNLL"
     misc_feature    217..1035
                     /gene="LOC106093299"
                     /note="The haloacid dehalogenase (HAD) superfamily
                     includes carbon and phosphorus hydrolases such as
                     2-haloalkonoate dehalogenase, epoxide hydrolase,
                     phosphoserine phosphatase, phosphomannomutase,
                     phosphoglycolate phosphatase, P-type ATPase, among others.
                     These...; Region: Haloacid Dehalogenase-like Hydrolases;
                     cl21460"
                     /db_xref="CDD:473868"
     misc_feature    order(229..243,331..336,808..810,883..888,898..903)
                     /gene="LOC106093299"
                     /note="active site"
                     /db_xref="CDD:319763"
ORIGIN      
        1 gattccaacg cttagttgca aacaagacac gtctcggtgg acaccacgaa aaagtggaaa
       61 gcacaaagca tttaatcgga tttcaactca atttggaatt aaatcatagc gttctatcat
      121 aattgtgttt cccccaaatt cgcaccaatg tcgaacaaaa actatattgc aaatttgtcc
      181 tatgttcaaa aacgtgattt tctcaactca ttcgatttgg ttttttgtga ctgtgacggc
      241 gttatctggc ataatttatt cgacccaata cctggtgcat cagatgccat cgcttattta
      301 cgagccaagg gaaaacaggt ggtttttgtc accaataaca gcataatgtc aacggcagat
      361 caattgaaaa agttctcaaa gtgtaacatc attgtaaaag agcatgaact cattcatcct
      421 gcaaaaacca tttccaacta tttaaagaac ctgggattcg aaggacttat cctttgcttt
      481 gcttcatcaa tttttaaaca gcatttgcgc gaaaatggat ttgaggtagt cgaagagaag
      541 gaacgtctta tagatggttc ggttttagat ctacgtaatg caatctacaa caaagatccc
      601 attaaagcag tgataattga tattgatttt aatttgaccg cgtggaaact gatgagggcc
      661 caagttcatt taaagaatcc agaatgctta tttattgctg gtgctgctga tccacgcatt
      721 cctttcggag gcaatgaact tttgggccca ggggcataca ttcgcttagt cgaagaagct
      781 aatcaacgaa aggcaaaagt atttggtaaa cccggcgcag agcttggaga gcttctgaaa
      841 gttatgttca atatcaagga tcctcaaaga gttcttatgg ttggcgatag cttgaaaagt
      901 gatattatat ttggcaagaa ttgtggtttt caaacattat ttgtgttagc tggaaatatg
      961 gaacaaagtg aatttgaagc tttgcagctg aacaagatgg atagaccgga ttttgttatt
     1021 gaaaaattat cagatttgag taatctatta taatatagtg tgatcctatt ataatataat
     1081 gtgaagcgaa tagtagaata gaagtgggtt ttatcctttg cctaagcctt tctaacgtat
     1141 attatattct aacatatgta tattattcaa atattccaat aaaaactaaa caattatttt
     1201 ttaaaaacta aaca