Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260349 1214 bp mRNA linear INV 02-SEP-2023 (LOC106093299), mRNA. ACCESSION XM_013260349 VERSION XM_013260349.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260349.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1214 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1214 /gene="LOC106093299" /note="uncharacterized LOC106093299; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106093299" CDS 148..1053 /gene="LOC106093299" /codon_start=1 /product="uncharacterized protein LOC106093299" /protein_id="XP_013115803.1" /db_xref="GeneID:106093299" /translation="MSNKNYIANLSYVQKRDFLNSFDLVFCDCDGVIWHNLFDPIPGA SDAIAYLRAKGKQVVFVTNNSIMSTADQLKKFSKCNIIVKEHELIHPAKTISNYLKNL GFEGLILCFASSIFKQHLRENGFEVVEEKERLIDGSVLDLRNAIYNKDPIKAVIIDID FNLTAWKLMRAQVHLKNPECLFIAGAADPRIPFGGNELLGPGAYIRLVEEANQRKAKV FGKPGAELGELLKVMFNIKDPQRVLMVGDSLKSDIIFGKNCGFQTLFVLAGNMEQSEF EALQLNKMDRPDFVIEKLSDLSNLL" misc_feature 217..1035 /gene="LOC106093299" /note="The haloacid dehalogenase (HAD) superfamily includes carbon and phosphorus hydrolases such as 2-haloalkonoate dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, among others. These...; Region: Haloacid Dehalogenase-like Hydrolases; cl21460" /db_xref="CDD:473868" misc_feature order(229..243,331..336,808..810,883..888,898..903) /gene="LOC106093299" /note="active site" /db_xref="CDD:319763" ORIGIN 1 gattccaacg cttagttgca aacaagacac gtctcggtgg acaccacgaa aaagtggaaa 61 gcacaaagca tttaatcgga tttcaactca atttggaatt aaatcatagc gttctatcat 121 aattgtgttt cccccaaatt cgcaccaatg tcgaacaaaa actatattgc aaatttgtcc 181 tatgttcaaa aacgtgattt tctcaactca ttcgatttgg ttttttgtga ctgtgacggc 241 gttatctggc ataatttatt cgacccaata cctggtgcat cagatgccat cgcttattta 301 cgagccaagg gaaaacaggt ggtttttgtc accaataaca gcataatgtc aacggcagat 361 caattgaaaa agttctcaaa gtgtaacatc attgtaaaag agcatgaact cattcatcct 421 gcaaaaacca tttccaacta tttaaagaac ctgggattcg aaggacttat cctttgcttt 481 gcttcatcaa tttttaaaca gcatttgcgc gaaaatggat ttgaggtagt cgaagagaag 541 gaacgtctta tagatggttc ggttttagat ctacgtaatg caatctacaa caaagatccc 601 attaaagcag tgataattga tattgatttt aatttgaccg cgtggaaact gatgagggcc 661 caagttcatt taaagaatcc agaatgctta tttattgctg gtgctgctga tccacgcatt 721 cctttcggag gcaatgaact tttgggccca ggggcataca ttcgcttagt cgaagaagct 781 aatcaacgaa aggcaaaagt atttggtaaa cccggcgcag agcttggaga gcttctgaaa 841 gttatgttca atatcaagga tcctcaaaga gttcttatgg ttggcgatag cttgaaaagt 901 gatattatat ttggcaagaa ttgtggtttt caaacattat ttgtgttagc tggaaatatg 961 gaacaaagtg aatttgaagc tttgcagctg aacaagatgg atagaccgga ttttgttatt 1021 gaaaaattat cagatttgag taatctatta taatatagtg tgatcctatt ataatataat 1081 gtgaagcgaa tagtagaata gaagtgggtt ttatcctttg cctaagcctt tctaacgtat 1141 attatattct aacatatgta tattattcaa atattccaat aaaaactaaa caattatttt 1201 ttaaaaacta aaca