Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093295


LOCUS       XM_013260345            1201 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093295), mRNA.
ACCESSION   XM_013260345
VERSION     XM_013260345.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260345.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1201
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1201
                     /gene="LOC106093295"
                     /note="uncharacterized LOC106093295; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106093295"
     CDS             1..945
                     /gene="LOC106093295"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093295"
                     /protein_id="XP_013115799.2"
                     /db_xref="GeneID:106093295"
                     /translation="MSQNNCKKPKHILHMNLKEKQTFLDSFDIVLSDCDGVLWNISAP
                     IPNAGAAINLLKIAGKAFKYVSNNDGRRSTEAYIKKVESIGARNILKNDFILPFKVLA
                     RHVKLNYPSETCYCIGTETFCQSLKETDVEVQNVTPGFDIKPDKLINAVTPIENAKLV
                     IVDIHINMTFIDLALIHQYLLKKNCMVYINAVDDRLTVSKDLKIVGPGLFTQALVECA
                     ERDLIIFGKPSDIMAEYIVDEFQISERKRALFAGDNLFADIKFGIQQGFQTLFVPTGV
                     HSITDMMTQMPENQPDYYADGLGDFVEFFNDITESLSK"
     polyA_site      1201
                     /gene="LOC106093295"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtcgcaaa ataattgtaa aaaacccaaa catattctgc acatgaattt aaaggaaaaa
       61 caaacttttt tggattcatt tgatattgtc ctctccgatt gtgatggagt tttgtggaat
      121 atatctgctc ctattcccaa tgcaggtgct gctattaatc ttcttaaaat tgccggcaag
      181 gcgtttaaat acgtatccaa taatgatggt cgtaggtcta ctgaagctta tatcaaaaag
      241 gtcgagagta taggtgctcg aaatattttg aagaatgatt ttatattacc atttaaagta
      301 cttgcaagac atgttaaact aaattacccc agcgagacat gctattgcat tggcacggaa
      361 acattctgtc agtcattgaa ggaaacagat gtggaagttc aaaatgtcac acccggattt
      421 gatataaaac ctgataaact cattaatgcg gtaacaccaa ttgaaaatgc caaattggtt
      481 atcgtagaca tacacattaa tatgacattc atcgacttgg ccttgattca tcaatatcta
      541 ttgaaaaaga attgtatggt ctacatcaat gcggttgatg atcgattgac agtatctaaa
      601 gatttaaaaa tagttggacc tggtctattt acacaagccc ttgtcgaatg tgcagaaaga
      661 gatttgatca tatttggtaa accgagcgat ataatggcag aatacatagt tgatgaattt
      721 caaatcagcg agcgtaaacg agcactgttt gcaggcgata atctatttgc tgatatcaaa
      781 tttggtattc aacaaggatt tcaaacatta ttcgttccaa caggggtcca tagcattaca
      841 gacatgatga cgcagatgcc agaaaatcaa ccggactatt atgctgatgg tctgggagac
      901 tttgtggaat tttttaatga tataacagaa agtttgtcca agtaatattc agtcgacatc
      961 aatagctagc ttaaaattgg agaacggaaa atatgcaaat gcgtattttg aatggagcgt
     1021 tggaaaaaga tttgaaatca ccgatttttt tatctaaagc ccaaaaattt tacatatatt
     1081 cctaaaggcg cattttattt gcatattttt cgccctgtag aaataatgac gatattttaa
     1141 aacctgaacc ataataaaca aataaattaa ttgagacgaa tgaatttcgt ctgtagctag
     1201 a