Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260345 1201 bp mRNA linear INV 02-SEP-2023 (LOC106093295), mRNA. ACCESSION XM_013260345 VERSION XM_013260345.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260345.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1201 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1201 /gene="LOC106093295" /note="uncharacterized LOC106093295; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106093295" CDS 1..945 /gene="LOC106093295" /codon_start=1 /product="uncharacterized protein LOC106093295" /protein_id="XP_013115799.2" /db_xref="GeneID:106093295" /translation="MSQNNCKKPKHILHMNLKEKQTFLDSFDIVLSDCDGVLWNISAP IPNAGAAINLLKIAGKAFKYVSNNDGRRSTEAYIKKVESIGARNILKNDFILPFKVLA RHVKLNYPSETCYCIGTETFCQSLKETDVEVQNVTPGFDIKPDKLINAVTPIENAKLV IVDIHINMTFIDLALIHQYLLKKNCMVYINAVDDRLTVSKDLKIVGPGLFTQALVECA ERDLIIFGKPSDIMAEYIVDEFQISERKRALFAGDNLFADIKFGIQQGFQTLFVPTGV HSITDMMTQMPENQPDYYADGLGDFVEFFNDITESLSK" polyA_site 1201 /gene="LOC106093295" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtcgcaaa ataattgtaa aaaacccaaa catattctgc acatgaattt aaaggaaaaa 61 caaacttttt tggattcatt tgatattgtc ctctccgatt gtgatggagt tttgtggaat 121 atatctgctc ctattcccaa tgcaggtgct gctattaatc ttcttaaaat tgccggcaag 181 gcgtttaaat acgtatccaa taatgatggt cgtaggtcta ctgaagctta tatcaaaaag 241 gtcgagagta taggtgctcg aaatattttg aagaatgatt ttatattacc atttaaagta 301 cttgcaagac atgttaaact aaattacccc agcgagacat gctattgcat tggcacggaa 361 acattctgtc agtcattgaa ggaaacagat gtggaagttc aaaatgtcac acccggattt 421 gatataaaac ctgataaact cattaatgcg gtaacaccaa ttgaaaatgc caaattggtt 481 atcgtagaca tacacattaa tatgacattc atcgacttgg ccttgattca tcaatatcta 541 ttgaaaaaga attgtatggt ctacatcaat gcggttgatg atcgattgac agtatctaaa 601 gatttaaaaa tagttggacc tggtctattt acacaagccc ttgtcgaatg tgcagaaaga 661 gatttgatca tatttggtaa accgagcgat ataatggcag aatacatagt tgatgaattt 721 caaatcagcg agcgtaaacg agcactgttt gcaggcgata atctatttgc tgatatcaaa 781 tttggtattc aacaaggatt tcaaacatta ttcgttccaa caggggtcca tagcattaca 841 gacatgatga cgcagatgcc agaaaatcaa ccggactatt atgctgatgg tctgggagac 901 tttgtggaat tttttaatga tataacagaa agtttgtcca agtaatattc agtcgacatc 961 aatagctagc ttaaaattgg agaacggaaa atatgcaaat gcgtattttg aatggagcgt 1021 tggaaaaaga tttgaaatca ccgatttttt tatctaaagc ccaaaaattt tacatatatt 1081 cctaaaggcg cattttattt gcatattttt cgccctgtag aaataatgac gatattttaa 1141 aacctgaacc ataataaaca aataaattaa ttgagacgaa tgaatttcgt ctgtagctag 1201 a