Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260342 1022 bp mRNA linear INV 02-SEP-2023 (LOC106093291), mRNA. ACCESSION XM_013260342 VERSION XM_013260342.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260342.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1022 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1022 /gene="LOC106093291" /note="SUN domain-containing protein 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106093291" CDS 15..938 /gene="LOC106093291" /codon_start=1 /product="SUN domain-containing protein 5" /protein_id="XP_013115796.1" /db_xref="GeneID:106093291" /translation="MLNTSNEIILTEVISSQIYIERISIIYLDNLSLNIMVVINRVCL CYLITTCLISAFVYTLIYHNLLYMKKIQKLSESVDEIAHVVFQTPKIGREAYDLSELV DDKVKKRLTGIWNELFALKKMIKRDDKSRSKNEISITKLEERVNYASDQLGAKIVHLE ATPHCPSNFIKSWMGADFLTNPPIKLLQSGMEPGNCFTFKNDEANVTIQLAHSIFIDE ILLDHITKKQSPIGDTSSAPKDFRIVAIHGDLYEIPLGNYKFNNDPDEPLQRYAVETP HPVEFLRLEFKSNHGNPNYTSIYRVAVFGKL" misc_feature 552..932 /gene="LOC106093291" /note="Sad1 / UNC-like C-terminal; Region: Sad1_UNC; cl23730" /db_xref="CDD:474037" polyA_site 1022 /gene="LOC106093291" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccttaagtaa tgccatgtta aacacttcaa acgaaattat tttgacagaa gtaatctcaa 61 gtcaaatata cattgagcga atttcgataa tctatttaga taatctatcg ctgaacataa 121 tggttgtaat aaatagagtt tgcctttgtt atcttattac cacatgtctc atcagtgcat 181 ttgtttatac tctaatctac cataatttac tgtatatgaa aaaaattcag aagttatccg 241 aaagtgtgga tgaaattgcg catgttgttt ttcagacacc aaagattggg agagaagctt 301 atgacctctc cgaattggtg gacgacaagg tgaaaaaacg tttaacagga atttggaatg 361 aattgtttgc gctcaagaaa atgatcaagc gagacgataa aagcagaagc aaaaatgaaa 421 tatccataac aaaattggag gaaagagtta attatgcctc agatcaattg ggggcaaaaa 481 ttgtacacct cgaggctaca ccgcattgtc ccagtaattt tattaaatcg tggatgggtg 541 cagatttttt aacaaatcct cccataaaat tgttacaatc tggaatggag cccggtaatt 601 gtttcacttt taaaaatgat gaagcaaatg ttaccattca attggcccat agcattttta 661 tagatgagat tttattagat catatcacaa aaaaacagtc gcccattggg gatacttcat 721 ctgcaccaaa ggattttcga attgttgcca tacatggtga tttatacgaa atccctttag 781 ggaattacaa attcaataat gacccagatg aacctctgca acgttatgct gttgagacac 841 ctcaccccgt cgaattttta cgtttagagt ttaaatccaa tcatggaaat cctaattaca 901 ccagcattta cagagttgct gtttttggaa aactataaag gccgtcgtat gaaaacttac 961 ttaaattttt tattatatta gtattatata ttttttaata aataaaatat atcttttaat 1021 tt