Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans SUN domain-containing protein 5


LOCUS       XM_013260342            1022 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093291), mRNA.
ACCESSION   XM_013260342
VERSION     XM_013260342.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260342.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1022
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1022
                     /gene="LOC106093291"
                     /note="SUN domain-containing protein 5; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:106093291"
     CDS             15..938
                     /gene="LOC106093291"
                     /codon_start=1
                     /product="SUN domain-containing protein 5"
                     /protein_id="XP_013115796.1"
                     /db_xref="GeneID:106093291"
                     /translation="MLNTSNEIILTEVISSQIYIERISIIYLDNLSLNIMVVINRVCL
                     CYLITTCLISAFVYTLIYHNLLYMKKIQKLSESVDEIAHVVFQTPKIGREAYDLSELV
                     DDKVKKRLTGIWNELFALKKMIKRDDKSRSKNEISITKLEERVNYASDQLGAKIVHLE
                     ATPHCPSNFIKSWMGADFLTNPPIKLLQSGMEPGNCFTFKNDEANVTIQLAHSIFIDE
                     ILLDHITKKQSPIGDTSSAPKDFRIVAIHGDLYEIPLGNYKFNNDPDEPLQRYAVETP
                     HPVEFLRLEFKSNHGNPNYTSIYRVAVFGKL"
     misc_feature    552..932
                     /gene="LOC106093291"
                     /note="Sad1 / UNC-like C-terminal; Region: Sad1_UNC;
                     cl23730"
                     /db_xref="CDD:474037"
     polyA_site      1022
                     /gene="LOC106093291"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccttaagtaa tgccatgtta aacacttcaa acgaaattat tttgacagaa gtaatctcaa
       61 gtcaaatata cattgagcga atttcgataa tctatttaga taatctatcg ctgaacataa
      121 tggttgtaat aaatagagtt tgcctttgtt atcttattac cacatgtctc atcagtgcat
      181 ttgtttatac tctaatctac cataatttac tgtatatgaa aaaaattcag aagttatccg
      241 aaagtgtgga tgaaattgcg catgttgttt ttcagacacc aaagattggg agagaagctt
      301 atgacctctc cgaattggtg gacgacaagg tgaaaaaacg tttaacagga atttggaatg
      361 aattgtttgc gctcaagaaa atgatcaagc gagacgataa aagcagaagc aaaaatgaaa
      421 tatccataac aaaattggag gaaagagtta attatgcctc agatcaattg ggggcaaaaa
      481 ttgtacacct cgaggctaca ccgcattgtc ccagtaattt tattaaatcg tggatgggtg
      541 cagatttttt aacaaatcct cccataaaat tgttacaatc tggaatggag cccggtaatt
      601 gtttcacttt taaaaatgat gaagcaaatg ttaccattca attggcccat agcattttta
      661 tagatgagat tttattagat catatcacaa aaaaacagtc gcccattggg gatacttcat
      721 ctgcaccaaa ggattttcga attgttgcca tacatggtga tttatacgaa atccctttag
      781 ggaattacaa attcaataat gacccagatg aacctctgca acgttatgct gttgagacac
      841 ctcaccccgt cgaattttta cgtttagagt ttaaatccaa tcatggaaat cctaattaca
      901 ccagcattta cagagttgct gtttttggaa aactataaag gccgtcgtat gaaaacttac
      961 ttaaattttt tattatatta gtattatata ttttttaata aataaaatat atcttttaat
     1021 tt