Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093290


LOCUS       XM_013260341             756 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093290), mRNA.
ACCESSION   XM_013260341
VERSION     XM_013260341.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260341.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..756
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..756
                     /gene="LOC106093290"
                     /note="uncharacterized LOC106093290; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106093290"
     CDS             76..690
                     /gene="LOC106093290"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093290"
                     /protein_id="XP_013115795.2"
                     /db_xref="GeneID:106093290"
                     /translation="MSLQKTCIVFTIACMALAMAKTQNVNGILPERSILNFMASSSRT
                     LQGNPTRSLECFEYYIPIIDETAQQYQWDLGNCTEAFENAQQAAFQASAEQRNQLAKT
                     VNDSCEILIECENAATAEDVYQCYINQGPTEAKTLYSVSIDATSQYATLEEKIRQAQS
                     DEEMCNIKARIIYEKDSTQAYAELNSCVLNETPIPTAAAPSSKV"
ORIGIN      
        1 tcgttgttct tacgtcctcg gcaatatacg actactttgt tgattagtct aaaagaggaa
       61 cgtttaatcc gaaatatgag tttacaaaag acttgtatcg tttttaccat tgcctgcatg
      121 gccttggcaa tggcaaagac ccaaaacgtc aatggaatcc ttcccgagcg cagcattctg
      181 aattttatgg caagttccag tcgaaccctt caaggaaatc ccacacgatc attggaatgc
      241 tttgaatatt atattcctat catcgatgaa acggcccaac aatatcaatg ggatttgggc
      301 aattgtacag aagcctttga aaatgctcaa caggcggctt ttcaagcatc agctgaacaa
      361 cgaaatcaat tggccaaaac agttaatgat tcctgtgaaa ttctaattga atgtgagaat
      421 gcagccacag ctgaagatgt ctatcaatgc tatataaatc agggtccaac tgaggcaaaa
      481 accttgtatt ctgtttcaat cgacgccact tcccagtatg caactctgga agagaaaatc
      541 cgccaagcgc agagtgatga agaaatgtgt aacataaagg ccagaataat ctacgaaaag
      601 gattcgaccc aagcctatgc tgaattgaat tcgtgcgttt tgaacgaaac tcccatccca
      661 actgctgcag caccttcttc caaagtataa tcgtcatcaa cttcagacgt tacggacact
      721 tcgtcagggt gtataccggc tactcccagt gacatc