Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260341 756 bp mRNA linear INV 02-SEP-2023 (LOC106093290), mRNA. ACCESSION XM_013260341 VERSION XM_013260341.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260341.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..756 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..756 /gene="LOC106093290" /note="uncharacterized LOC106093290; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106093290" CDS 76..690 /gene="LOC106093290" /codon_start=1 /product="uncharacterized protein LOC106093290" /protein_id="XP_013115795.2" /db_xref="GeneID:106093290" /translation="MSLQKTCIVFTIACMALAMAKTQNVNGILPERSILNFMASSSRT LQGNPTRSLECFEYYIPIIDETAQQYQWDLGNCTEAFENAQQAAFQASAEQRNQLAKT VNDSCEILIECENAATAEDVYQCYINQGPTEAKTLYSVSIDATSQYATLEEKIRQAQS DEEMCNIKARIIYEKDSTQAYAELNSCVLNETPIPTAAAPSSKV" ORIGIN 1 tcgttgttct tacgtcctcg gcaatatacg actactttgt tgattagtct aaaagaggaa 61 cgtttaatcc gaaatatgag tttacaaaag acttgtatcg tttttaccat tgcctgcatg 121 gccttggcaa tggcaaagac ccaaaacgtc aatggaatcc ttcccgagcg cagcattctg 181 aattttatgg caagttccag tcgaaccctt caaggaaatc ccacacgatc attggaatgc 241 tttgaatatt atattcctat catcgatgaa acggcccaac aatatcaatg ggatttgggc 301 aattgtacag aagcctttga aaatgctcaa caggcggctt ttcaagcatc agctgaacaa 361 cgaaatcaat tggccaaaac agttaatgat tcctgtgaaa ttctaattga atgtgagaat 421 gcagccacag ctgaagatgt ctatcaatgc tatataaatc agggtccaac tgaggcaaaa 481 accttgtatt ctgtttcaat cgacgccact tcccagtatg caactctgga agagaaaatc 541 cgccaagcgc agagtgatga agaaatgtgt aacataaagg ccagaataat ctacgaaaag 601 gattcgaccc aagcctatgc tgaattgaat tcgtgcgttt tgaacgaaac tcccatccca 661 actgctgcag caccttcttc caaagtataa tcgtcatcaa cttcagacgt tacggacact 721 tcgtcagggt gtataccggc tactcccagt gacatc