Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260340 838 bp mRNA linear INV 02-SEP-2023 (LOC106093288), mRNA. ACCESSION XM_013260340 VERSION XM_013260340.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260340.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..838 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..838 /gene="LOC106093288" /note="uncharacterized LOC106093288; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106093288" CDS 98..712 /gene="LOC106093288" /codon_start=1 /product="uncharacterized protein LOC106093288" /protein_id="XP_013115794.2" /db_xref="GeneID:106093288" /translation="MSLQNTFIVFTIACMALVMAKTQRLNGLLPERSILNFMASSSRA LQGNPTRSLECFDYYIPIIDETAQQYQWDLGNCTEAFENAQQAAFQASSEQRNQLAKT VNDSCEILIECENAATAEDVYQCYINQGPTEAKTLYTVSIDATSQYATLEEKIRQAQS EEDMCNTKARISYEKDSTQAYGELNSCILNDTPIPTTATPSSKV" ORIGIN 1 aaacagttat tgccaaattt tttcgttgtt ctaacgtcct cgataatata cgaatacttt 61 ttttattaat ctaaaaacga aacattaaat ccgaaatatg agtttacaaa atactttcat 121 cgtttttacc attgcctgca tggccttggt aatggcaaag acccaacgcc tcaatggact 181 cctccctgag cgcagcattc tgaatttcat ggcaagttcc agtagagccc ttcaaggaaa 241 tcccacacga tcattggaat gctttgatta ttatattcct atcatcgatg aaacggccca 301 acaatatcaa tgggatttgg gcaattgtac agaagccttt gagaatgctc aacaggccgc 361 tttccaagca tcatctgaac aacgaaatca attggccaag acagttaatg attcctgtga 421 aattctaata gaatgtgaga atgcagccac agctgaagat gtctaccaat gctatataaa 481 tcagggtcct actgaggcaa aaaccttgta tactgtttca atcgatgcca cttcccagta 541 tgcaactctg gaagagaaaa tccgccaagc gcagagtgaa gaagacatgt gtaacactaa 601 ggccagaata tcttacgaaa aggattcgac ccaagcctat ggtgaattga attcgtgcat 661 tttgaacgat actcccatcc caactactgc aacaccttct tcaaaagtgt aatcgtcatc 721 aacttcaaat gttactgaaa tttcgtcaga gtctataccc gctaccccca gtgacatcaa 781 atctgaggaa gacattttca aaggctttcc ttgttttgtt aaattcttag aaaaagca