Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093288


LOCUS       XM_013260340             838 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093288), mRNA.
ACCESSION   XM_013260340
VERSION     XM_013260340.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260340.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..838
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..838
                     /gene="LOC106093288"
                     /note="uncharacterized LOC106093288; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106093288"
     CDS             98..712
                     /gene="LOC106093288"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093288"
                     /protein_id="XP_013115794.2"
                     /db_xref="GeneID:106093288"
                     /translation="MSLQNTFIVFTIACMALVMAKTQRLNGLLPERSILNFMASSSRA
                     LQGNPTRSLECFDYYIPIIDETAQQYQWDLGNCTEAFENAQQAAFQASSEQRNQLAKT
                     VNDSCEILIECENAATAEDVYQCYINQGPTEAKTLYTVSIDATSQYATLEEKIRQAQS
                     EEDMCNTKARISYEKDSTQAYGELNSCILNDTPIPTTATPSSKV"
ORIGIN      
        1 aaacagttat tgccaaattt tttcgttgtt ctaacgtcct cgataatata cgaatacttt
       61 ttttattaat ctaaaaacga aacattaaat ccgaaatatg agtttacaaa atactttcat
      121 cgtttttacc attgcctgca tggccttggt aatggcaaag acccaacgcc tcaatggact
      181 cctccctgag cgcagcattc tgaatttcat ggcaagttcc agtagagccc ttcaaggaaa
      241 tcccacacga tcattggaat gctttgatta ttatattcct atcatcgatg aaacggccca
      301 acaatatcaa tgggatttgg gcaattgtac agaagccttt gagaatgctc aacaggccgc
      361 tttccaagca tcatctgaac aacgaaatca attggccaag acagttaatg attcctgtga
      421 aattctaata gaatgtgaga atgcagccac agctgaagat gtctaccaat gctatataaa
      481 tcagggtcct actgaggcaa aaaccttgta tactgtttca atcgatgcca cttcccagta
      541 tgcaactctg gaagagaaaa tccgccaagc gcagagtgaa gaagacatgt gtaacactaa
      601 ggccagaata tcttacgaaa aggattcgac ccaagcctat ggtgaattga attcgtgcat
      661 tttgaacgat actcccatcc caactactgc aacaccttct tcaaaagtgt aatcgtcatc
      721 aacttcaaat gttactgaaa tttcgtcaga gtctataccc gctaccccca gtgacatcaa
      781 atctgaggaa gacattttca aaggctttcc ttgttttgtt aaattcttag aaaaagca