Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260337 836 bp mRNA linear INV 02-SEP-2023 (LOC106093285), mRNA. ACCESSION XM_013260337 VERSION XM_013260337.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260337.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..836 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..836 /gene="LOC106093285" /note="uncharacterized LOC106093285; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106093285" CDS 117..821 /gene="LOC106093285" /codon_start=1 /product="uncharacterized protein LOC106093285" /protein_id="XP_013115791.2" /db_xref="GeneID:106093285" /translation="MSIRKSFIVFTIACLALAKANPQNINALLPERSILNFMASSSQT LQDNPTQSLACFNYYIPLIDEVAQEYQYDLSNCSSNFQKSQQSAIDATVDERNQLAKT VNGTCAVLVQCENEDTADDIFQCYINQGPVEAKALYGVATNATSQYAALEELIRQAQN IQDMCNTQAKVKYENNSTQAYAELNSCILNNTPIPSSTVAPPSSPSSSASTDNTSSSA STAAETSTAPPTTTSA" ORIGIN 1 aacctttgtc ttcaaatagc aacgaacagt tattgcgaaa tttgttagga atcatattgt 61 cgaacaaata tagctgaagt gattaaacga aaagttttag tgaccaaata cgtaatatga 121 gcatacggaa gagttttatt gttttcacca ttgcctgtct ggctttggct aaggcaaacc 181 cacaaaacat caacgcatta ctcccagaac gcagcatctt gaattttatg gcaagttcga 241 gtcaaacgct acaagataac cctacccaat ctttggcatg tttcaactac tatattcccc 301 tgatcgatga agttgcccag gagtatcaat atgacttgag caactgctct tctaacttcc 361 agaagtccca acagtctgcc atcgacgcta cagtcgatga acgtaaccaa ttggcgaaga 421 ctgtaaatgg cacctgtgct gttctggtac aatgcgagaa tgaagacaca gccgacgata 481 tcttccaatg ttatatcaat cagggacccg tcgaagctaa agccttgtat ggtgtcgcca 541 ccaatgctac ttcccaatat gctgctctcg aggagctgat tcgtcaggct cagaatatac 601 aagacatgtg taacacacaa gctaaagtta aatacgaaaa taattctaca caagcctatg 661 cggaattgaa ttcctgcatt ttgaataata cccccattcc atcatcaact gtagcaccac 721 cgtcatcacc atcatcctct gcatcaactg ataatacctc ttcatctgct tcaacggctg 781 ccgaaacatc tactgctcct cctactacca cttctgcata gtataatgag agcatg