Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein LST8 homolog (LOC106093276),


LOCUS       XM_013260328            1461 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013260328
VERSION     XM_013260328.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260328.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1461
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1461
                     /gene="LOC106093276"
                     /note="protein LST8 homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106093276"
     CDS             128..1075
                     /gene="LOC106093276"
                     /codon_start=1
                     /product="protein LST8 homolog"
                     /protein_id="XP_013115782.1"
                     /db_xref="GeneID:106093276"
                     /translation="METTGDQLILATGGYDHTIKLWQAHTGNCIRTLRFVETSQVNAL
                     DRTPDKTRLAACGYQCIRLYDLESSSNVPVINFESVQKNVTRLGFQEDGNWMFTAGED
                     HRVRIWDMLSASPHCSRVFDCQAPVNAACLHPNQVEIAMGAQNGGVYLWDVKSEVHEQ
                     LIPEVDASIQDVAISPDGQFMAAVNNKGNCYIWTLSCSPNQKLTTLHPKLKIAAHKRY
                     VLRCKFSPDSRLLVTTSGDGTARVWKTDDFTMWRELCIENYWVWDAAFSADSKYLFTA
                     SSDAIARLWKLETKNPERKYTGHTKAITALSFKDEIVTE"
     misc_feature    <143..1051
                     /gene="LOC106093276"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    251..364
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    377..493
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    509..613
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    632..748
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    782..895
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    908..982
                     /gene="LOC106093276"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     polyA_site      1461
                     /gene="LOC106093276"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgacatatg acggaattga acaaaacaaa acaataccac ccagacctaa agttcaggat
       61 tttataaaaa aagtatgaaa atttaagaaa attttgcaaa gtagataata aaatccttaa
      121 ttatattatg gaaacgacgg gtgaccaatt gatattggcc acgggaggat atgaccacac
      181 aattaaattg tggcaggctc ataccggtaa ctgtatacgc acgttacggt ttgtggaaac
      241 atcgcaagtt aatgcgttgg accgtacgcc agataaaaca cgcttggctg cctgcggcta
      301 tcagtgcata cgcctttatg acctagagtc cagttccaat gtgccggtta tcaatttcga
      361 aagtgtgcag aaaaatgtca ctcgtttggg gtttcaagag gatggcaatt ggatgttcac
      421 agcaggagag gaccatcgtg ttcgtatttg ggatatgctc tcggcctcgc cgcattgttc
      481 acgagtattc gactgtcagg cgccagtaaa tgcagcctgt ctgcatccaa atcaagttga
      541 gattgctatg ggggcacaaa acggtggtgt ctacttgtgg gatgtaaaat ccgaggtgca
      601 cgaacaactg atacccgaag tggatgcatc gatacaagat gtagccatat cacctgatgg
      661 ccaattcatg gccgcagtta ataacaaagg aaattgttat atctggactt taagctgctc
      721 gccaaatcaa aaactcacca cactacaccc caaactcaaa attgcggcgc acaagcgcta
      781 tgtgctgcgg tgtaaatttt ccccagactc gcgtctgctt gttactacct ctggtgatgg
      841 aactgctcgc gtttggaaaa ctgatgattt taccatgtgg cgtgagcttt gcattgaaaa
      901 ctattgggta tgggatgcgg catttagtgc agattccaaa tatctgttta cggcatccag
      961 tgatgccatc gcacggttat ggaaattaga aacgaaaaat cccgaacgta agtacaccgg
     1021 ccacacaaaa gccataacgg ccctttcgtt taaagacgaa attgtaaccg aataacatca
     1081 agcattaaca cggaaggcgt tggcggcatc taaaggctat gttacagcaa caaagccctg
     1141 gttttgtgct agcatttgcc gcaaactctc aatgtaattg gatgaatgat aagtaggtag
     1201 gaaaagaaaa tgtattgtgt tttggttgca ataaaatgca agggaagtaa tacactagag
     1261 tacccaacgg caacgcaatc atcgaccata ctatatattt tcctgattta tatatttttt
     1321 tgtcctgtac tgaggtaatt ttttctaggc atacctacaa ctactacatg tactatttaa
     1381 ttaagatatg ttttttatga gtaatacata acaatgtacg aaagaaatac aaaaaaaaat
     1441 aataaacaac atgaaaaaca a