Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260328 1461 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013260328 VERSION XM_013260328.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260328.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1461 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1461 /gene="LOC106093276" /note="protein LST8 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106093276" CDS 128..1075 /gene="LOC106093276" /codon_start=1 /product="protein LST8 homolog" /protein_id="XP_013115782.1" /db_xref="GeneID:106093276" /translation="METTGDQLILATGGYDHTIKLWQAHTGNCIRTLRFVETSQVNAL DRTPDKTRLAACGYQCIRLYDLESSSNVPVINFESVQKNVTRLGFQEDGNWMFTAGED HRVRIWDMLSASPHCSRVFDCQAPVNAACLHPNQVEIAMGAQNGGVYLWDVKSEVHEQ LIPEVDASIQDVAISPDGQFMAAVNNKGNCYIWTLSCSPNQKLTTLHPKLKIAAHKRY VLRCKFSPDSRLLVTTSGDGTARVWKTDDFTMWRELCIENYWVWDAAFSADSKYLFTA SSDAIARLWKLETKNPERKYTGHTKAITALSFKDEIVTE" misc_feature <143..1051 /gene="LOC106093276" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 251..364 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 377..493 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 509..613 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 632..748 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 782..895 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 908..982 /gene="LOC106093276" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" polyA_site 1461 /gene="LOC106093276" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgacatatg acggaattga acaaaacaaa acaataccac ccagacctaa agttcaggat 61 tttataaaaa aagtatgaaa atttaagaaa attttgcaaa gtagataata aaatccttaa 121 ttatattatg gaaacgacgg gtgaccaatt gatattggcc acgggaggat atgaccacac 181 aattaaattg tggcaggctc ataccggtaa ctgtatacgc acgttacggt ttgtggaaac 241 atcgcaagtt aatgcgttgg accgtacgcc agataaaaca cgcttggctg cctgcggcta 301 tcagtgcata cgcctttatg acctagagtc cagttccaat gtgccggtta tcaatttcga 361 aagtgtgcag aaaaatgtca ctcgtttggg gtttcaagag gatggcaatt ggatgttcac 421 agcaggagag gaccatcgtg ttcgtatttg ggatatgctc tcggcctcgc cgcattgttc 481 acgagtattc gactgtcagg cgccagtaaa tgcagcctgt ctgcatccaa atcaagttga 541 gattgctatg ggggcacaaa acggtggtgt ctacttgtgg gatgtaaaat ccgaggtgca 601 cgaacaactg atacccgaag tggatgcatc gatacaagat gtagccatat cacctgatgg 661 ccaattcatg gccgcagtta ataacaaagg aaattgttat atctggactt taagctgctc 721 gccaaatcaa aaactcacca cactacaccc caaactcaaa attgcggcgc acaagcgcta 781 tgtgctgcgg tgtaaatttt ccccagactc gcgtctgctt gttactacct ctggtgatgg 841 aactgctcgc gtttggaaaa ctgatgattt taccatgtgg cgtgagcttt gcattgaaaa 901 ctattgggta tgggatgcgg catttagtgc agattccaaa tatctgttta cggcatccag 961 tgatgccatc gcacggttat ggaaattaga aacgaaaaat cccgaacgta agtacaccgg 1021 ccacacaaaa gccataacgg ccctttcgtt taaagacgaa attgtaaccg aataacatca 1081 agcattaaca cggaaggcgt tggcggcatc taaaggctat gttacagcaa caaagccctg 1141 gttttgtgct agcatttgcc gcaaactctc aatgtaattg gatgaatgat aagtaggtag 1201 gaaaagaaaa tgtattgtgt tttggttgca ataaaatgca agggaagtaa tacactagag 1261 tacccaacgg caacgcaatc atcgaccata ctatatattt tcctgattta tatatttttt 1321 tgtcctgtac tgaggtaatt ttttctaggc atacctacaa ctactacatg tactatttaa 1381 ttaagatatg ttttttatga gtaatacata acaatgtacg aaagaaatac aaaaaaaaat 1441 aataaacaac atgaaaaaca a