Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093262


LOCUS       XM_013260312             569 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093262), mRNA.
ACCESSION   XM_013260312
VERSION     XM_013260312.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260312.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 40% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..569
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..569
                     /gene="LOC106093262"
                     /note="uncharacterized LOC106093262; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106093262"
     CDS             1..513
                     /gene="LOC106093262"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093262"
                     /protein_id="XP_013115766.2"
                     /db_xref="GeneID:106093262"
                     /translation="MAKFIIDKEFFGNEAKIIKFTKLECKDYDKSFIQFKQCQLKAVG
                     RNRIALQLHGDLKKNIDEELTINAELFRKSHDFRPFMYNDTMEFCSFVRNPNRYMFWK
                     ILVQDMIQFTNINHTCPYENEIIIKDLILEENMFKTLPFPGNDYMVHVKAILQNEIKA
                     ELKVYVVLIE"
ORIGIN      
        1 atggctaaat ttatcattga taaagagttc tttggcaatg aagcaaaaat cattaaattc
       61 accaagctgg agtgcaagga ctatgacaaa tcctttatcc agttcaagca atgccaattg
      121 aaggcggtgg gacgcaatcg cattgccttg caattgcatg gtgatttgaa gaagaacatc
      181 gacgaagagc ttacaatcaa tgcagaacta tttaggaaaa gtcatgattt ccgtccattc
      241 atgtacaatg acaccatgga gttttgcagc tttgtaagaa atcccaatcg ctacatgttt
      301 tggaagatct tggtgcagga tatgatacag tttacaaata tcaaccacac ctgtccctat
      361 gagaacgaga tcatcatcaa ggatcttatt ttggaggaga acatgttcaa aaccttaccc
      421 tttcccggca atgactacat ggttcatgtg aaggctatcc tgcagaatga aatcaaggcg
      481 gaacttaagg tctatgtggt gttgattgag tgaaagagtt ttgtggggcg cactccccct
      541 accgaaaaac tctgctgttg ctgtaatta