Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260257 1134 bp mRNA linear INV 02-SEP-2023 (LOC106093230), mRNA. ACCESSION XM_013260257 VERSION XM_013260257.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260257.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1134 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1134 /gene="LOC106093230" /note="uncharacterized LOC106093230; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106093230" CDS 67..1053 /gene="LOC106093230" /codon_start=1 /product="uncharacterized protein LOC106093230" /protein_id="XP_013115711.1" /db_xref="GeneID:106093230" /translation="MDSGRKLKKYLSDSNPRDLIREVKRRPGLYDKSKLDQPKREHKQ QLWTEVAESLTVPDEWDNFTVDEKEAKVDEVQHKWKHLRNHFLREVKLIRTGQAHTKR KYIYYNDLEFLNPFVGMKFSGRGKQSTKSGDSMDEDEYDTDQDNSVNKEDEADEKSHS FEEIQVDNERRKSPRRAVKVAPRKIPQHFSSTPKELTREQIINKFDGLKKVSERIRRP PSTPTVTQVKNPIPSISMRDGDISFCLSLVPTMRKLEESKRLKAKIEILTILHKYVET EDIPKVKRRQPESYRNNDDEKSKDMFEVNFSNNIKPEDSDGSDRNTKNVWWT" misc_feature 118..414 /gene="LOC106093230" /note="subfamily of SANT domain; Region: MADF; smart00595" /db_xref="CDD:214738" misc_feature 778..882 /gene="LOC106093230" /note="BESS motif; Region: BESS; pfam02944" /db_xref="CDD:460758" polyA_site 1134 /gene="LOC106093230" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attcggttaa tcgacttttc agtaacatac tctgtggaaa aagagggacg ctttgatcca 61 ataaacatgg attctgggag aaaattaaaa aagtatctat cagattcaaa tccaagagat 121 ttaatacgtg aagtgaaacg gcgaccgggg ctatatgata agtcaaagct tgatcagcct 181 aaaagggaac ataagcagca gctatggaca gaagtcgcag aaagcttgac agtaccggac 241 gaatgggaca atttcacagt ggatgaaaaa gaagcaaaag ttgatgaagt ccagcacaaa 301 tggaaacatt tacgaaatca ttttcttcga gaggttaaac ttataagaac cggccaagcc 361 catacaaaaa gaaagtatat atactataat gatctagagt ttctaaatcc atttgttggt 421 atgaaatttt ctggcagagg taaacagagt accaaatctg gagactccat ggatgaagac 481 gaatatgata cagatcaaga taatagtgtt aataaggaag atgaggccga tgagaaatct 541 catagctttg aggaaataca agttgataac gaacgtagaa agagcccacg tcgagcagta 601 aaagttgcgc ccagaaaaat accccaacat tttagttcca ctcctaaaga gttaacaagg 661 gaacaaataa taaacaagtt tgatgggttg aagaaagtct cagaaagaat tcgtcgccct 721 cctagcacac caacagtgac acaagttaaa aacccaattc cctcgattag tatgcgcgat 781 ggggacatat ctttttgcct ttccttggtg ccaactatgc gtaaattgga agaaagcaaa 841 aggttaaagg ctaaaattga aatccttaca attctccaca agtacgttga aacagaagat 901 attcccaaag tcaaaaggag acaaccggaa tcttatcgca ataacgatga tgaaaaatct 961 aaagatatgt ttgaggtcaa cttttcaaac aatattaagc cggaagactc ggatggctca 1021 gatagaaata caaaaaatgt atggtggacg taacatggaa acgaggattt tcgggattgt 1081 gaactatttt tttcttaagt ttcaaataaa ttatcattgt aaatcctata ctaa