Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093230


LOCUS       XM_013260257            1134 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093230), mRNA.
ACCESSION   XM_013260257
VERSION     XM_013260257.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260257.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1134
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1134
                     /gene="LOC106093230"
                     /note="uncharacterized LOC106093230; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106093230"
     CDS             67..1053
                     /gene="LOC106093230"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093230"
                     /protein_id="XP_013115711.1"
                     /db_xref="GeneID:106093230"
                     /translation="MDSGRKLKKYLSDSNPRDLIREVKRRPGLYDKSKLDQPKREHKQ
                     QLWTEVAESLTVPDEWDNFTVDEKEAKVDEVQHKWKHLRNHFLREVKLIRTGQAHTKR
                     KYIYYNDLEFLNPFVGMKFSGRGKQSTKSGDSMDEDEYDTDQDNSVNKEDEADEKSHS
                     FEEIQVDNERRKSPRRAVKVAPRKIPQHFSSTPKELTREQIINKFDGLKKVSERIRRP
                     PSTPTVTQVKNPIPSISMRDGDISFCLSLVPTMRKLEESKRLKAKIEILTILHKYVET
                     EDIPKVKRRQPESYRNNDDEKSKDMFEVNFSNNIKPEDSDGSDRNTKNVWWT"
     misc_feature    118..414
                     /gene="LOC106093230"
                     /note="subfamily of SANT domain; Region: MADF; smart00595"
                     /db_xref="CDD:214738"
     misc_feature    778..882
                     /gene="LOC106093230"
                     /note="BESS motif; Region: BESS; pfam02944"
                     /db_xref="CDD:460758"
     polyA_site      1134
                     /gene="LOC106093230"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attcggttaa tcgacttttc agtaacatac tctgtggaaa aagagggacg ctttgatcca
       61 ataaacatgg attctgggag aaaattaaaa aagtatctat cagattcaaa tccaagagat
      121 ttaatacgtg aagtgaaacg gcgaccgggg ctatatgata agtcaaagct tgatcagcct
      181 aaaagggaac ataagcagca gctatggaca gaagtcgcag aaagcttgac agtaccggac
      241 gaatgggaca atttcacagt ggatgaaaaa gaagcaaaag ttgatgaagt ccagcacaaa
      301 tggaaacatt tacgaaatca ttttcttcga gaggttaaac ttataagaac cggccaagcc
      361 catacaaaaa gaaagtatat atactataat gatctagagt ttctaaatcc atttgttggt
      421 atgaaatttt ctggcagagg taaacagagt accaaatctg gagactccat ggatgaagac
      481 gaatatgata cagatcaaga taatagtgtt aataaggaag atgaggccga tgagaaatct
      541 catagctttg aggaaataca agttgataac gaacgtagaa agagcccacg tcgagcagta
      601 aaagttgcgc ccagaaaaat accccaacat tttagttcca ctcctaaaga gttaacaagg
      661 gaacaaataa taaacaagtt tgatgggttg aagaaagtct cagaaagaat tcgtcgccct
      721 cctagcacac caacagtgac acaagttaaa aacccaattc cctcgattag tatgcgcgat
      781 ggggacatat ctttttgcct ttccttggtg ccaactatgc gtaaattgga agaaagcaaa
      841 aggttaaagg ctaaaattga aatccttaca attctccaca agtacgttga aacagaagat
      901 attcccaaag tcaaaaggag acaaccggaa tcttatcgca ataacgatga tgaaaaatct
      961 aaagatatgt ttgaggtcaa cttttcaaac aatattaagc cggaagactc ggatggctca
     1021 gatagaaata caaaaaatgt atggtggacg taacatggaa acgaggattt tcgggattgt
     1081 gaactatttt tttcttaagt ttcaaataaa ttatcattgt aaatcctata ctaa