PREDICTED: Stomoxys calcitrans histidine-rich glycoprotein

LOCUS       XM_013260230             440 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093211), mRNA.
ACCESSION   XM_013260230
VERSION     XM_013260230.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260230.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 9% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..440
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..440
                     /gene="LOC106093211"
                     /note="histidine-rich glycoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106093211"
     CDS             18..440
                     /gene="LOC106093211"
                     /codon_start=1
                     /product="histidine-rich glycoprotein"
                     /protein_id="XP_013115684.1"
                     /db_xref="GeneID:106093211"
                     /translation="MNSRQLFLQIFLVLGLVLVLYSDCASAGKNSKKKKIVIHVPIHK
                     KIEKHTHTIVKHIHHHHKPIVVKEEKKIIEEHHPIIKKEHVSHEHHHKHDHGHQHKHV
                     EPAKEYDDEEEHIHHHHSYEHKSTGHDEEVDDDFLERH"
ORIGIN      
        1 ctaccaaccc caacatcatg aacagtcggc agttgttttt gcaaattttt cttgtgcttg
       61 gattggtctt agtgttgtac agtgattgtg catcagcggg aaaaaattca aaaaagaaga
      121 aaatcgtcat tcacgtgcct atccataaga aaattgaaaa gcatacccac accattgtaa
      181 agcacatcca tcatcatcac aagccgattg tcgtgaaaga ggagaagaag atcatcgaag
      241 agcatcatcc gattatcaag aaagagcatg tatcccacga gcatcaccat aaacacgatc
      301 atggccatca gcataaacat gtcgaaccgg ccaaagaata tgacgatgag gaggagcaca
      361 ttcatcatca tcacagctat gagcacaaat ctacagggca tgatgaagaa gtcgatgatg
      421 atttcttgga aaggcactaa