Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260169 1153 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013260169 VERSION XM_013260169.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260169.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1153 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1153 /gene="LOC106093153" /note="nucleoporin Nup35; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106093153" CDS 56..1093 /gene="LOC106093153" /codon_start=1 /product="nucleoporin Nup35" /protein_id="XP_013115623.1" /db_xref="GeneID:106093153" /translation="MEPMALGSPSGSPATNPYLPSFLLGEQQTPSTPRNNTLSPNKAG NRNLSFGFATSPGASNSPQQDYNRSGLGQKTLFGGYQQTPPIQQNSNFPGTPMQSHNT SISGPPTQGLFDSLRNERNQVQTPTRSLQPQSQLGTPIIGNHNASIASTYALNQSIQQ QMANVTGQFNDSYNNASFNTSRAGIMSPMLPGAPVNNSQLLQCPPQPRYTEFWITVFG FPSSATAVVLQHFAQCGTIVDKVFPSQNGNWVHLKYSSRLECDKALNYNEKILSNNIM IGVTQCKDKAIIDKENICENNGQQNVKIRPLAQTAYKSAQNDTSVVSNPNAPQKSSGI MNKAMDLFFGW" misc_feature 686..907 /gene="LOC106093153" /note="RNA recognition motif (RRM) found in nucleoporin Nup53 and similar proteins; Region: RRM_Nup53_like; cd12441" /db_xref="CDD:409875" misc_feature order(698..700,704..709,794..802,857..859,863..865, 878..889,893..895) /gene="LOC106093153" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:409875" polyA_site 1153 /gene="LOC106093153" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatcatattt gacttttaga caatagaagc ggcgaccagg ccaggaaatt taaatatgga 61 accaatggcc ttaggcagtc caagtggtag tccggctaca aacccatatt tgccttcatt 121 tctattgggt gagcaacaga ccccatccac gcctcgcaac aatactcttt ccccgaacaa 181 ggctggtaat aggaatcttt cattcggttt tgcaacttcg cccggagctt caaactcacc 241 acagcaagac tataataggt caggcttggg gcaaaaaacg ctatttggtg gatatcagca 301 aacacctccc attcaacaaa actcgaattt tcccggcacc ccaatgcaaa gtcacaatac 361 cagcatttca gggccaccaa cgcagggact tttcgattct ttgcgtaatg aacgtaatca 421 ggtgcaaacg ccaacgagat cattgcagcc tcaatctcaa ttaggtactc ccattattgg 481 caaccataat gccagtattg cttctaccta tgccctaaat caaagtattc aacaacaaat 541 ggccaatgtc acggggcagt ttaacgattc gtacaacaat gcttccttta atacatccag 601 ggctggcatt atgtcgccta tgctgccagg agctccagta aataattcgc aattgttaca 661 gtgcccgcca caacctcgtt ataccgaatt ttggataact gtgtttggat ttccctcgag 721 cgctacagct gtagttttgc agcactttgc acaatgtgga acaatcgtgg acaaagtctt 781 tccttcccaa aatggcaatt gggtgcactt gaagtattcc tctaggcttg agtgtgataa 841 agccctcaac tataatgaga agatattatc caataacata atgattgggg tcacacaatg 901 taaagataaa gctataattg ataaagaaaa tatttgtgaa aataatggcc aacaaaatgt 961 gaaaattcgt ccattagccc agacggcata taaaagcgct cagaatgaca catcggttgt 1021 ctcaaatccc aacgccccac agaagagttc gggaatcatg aacaaagcaa tggatttatt 1081 ttttggttgg taatgatcga aaaaataaat tcaatcaact tatgcgtaga tcacattctt 1141 tgtttaaaat aaa