Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013260167 1138 bp mRNA linear INV 02-SEP-2023 (LOC106093152), mRNA. ACCESSION XM_013260167 VERSION XM_013260167.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013260167.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1138 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1138 /gene="LOC106093152" /note="uncharacterized LOC106093152; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106093152" CDS 115..1026 /gene="LOC106093152" /codon_start=1 /product="uncharacterized protein LOC106093152" /protein_id="XP_013115621.1" /db_xref="GeneID:106093152" /translation="MSNGITKPEILRPLTEPELEELLQLYKQKYGIDSPQYLLIYNQC KWNEKLKELKISDQNKKWISFRREFYTHAKGDFRTYGTYICLHQDLIQSVTFHTWQPD FKELLECLDKTELICWQSGPLLVNVAAEYSKELRQIIANKGVTIQRARSSSLFVLKRE NALNLDPPVIPDGYELRQLQQEDAELVHSHWPNKKEGSLDYLKGLIEIDTTFGVFKKA DNSLIAWIFRNEFSGLGILQVLESEQRKGFGTIVVKAISYAIAKTESINITAWILLEN VKSQTLFRNIGFEARLVNQWIQLNKIE" misc_feature 184..528 /gene="LOC106093152" /note="Domain of unknown function (DUF5645); Region: DUF5645; pfam18713" /db_xref="CDD:436686" misc_feature 751..1005 /gene="LOC106093152" /note="NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, from bacterial antibiotic resistance to circadian rhythms in mammals. Members...; Region: N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate; cl17182" /db_xref="CDD:473072" polyA_site 1138 /gene="LOC106093152" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aactacacgt ccagccatct ccacactacc gtcagtagta gttgcagaca attcagttcc 61 aatcggcaaa ttatcgctac aaaagttaca aaatattcag ataacgacgc aataatgtca 121 aacggcataa ctaagcctga aattttaagg cctctaactg aacctgaact tgaagaactt 181 ttgcaactat ataaacaaaa atatggcatt gatagtcctc aatatctgct catctacaat 241 cagtgtaaat ggaatgaaaa actaaaagaa ttgaaaatat cggatcaaaa taaaaaatgg 301 atttcatttc gcagagaatt ttatacacat gcaaaaggtg actttaggac atacggtacc 361 tatatatgtc tccatcaaga cttaatccaa agtgttacct ttcacacttg gcaaccggat 421 tttaaagaat tattagaatg tctggacaaa actgaactga tatgttggca gagtggtcct 481 ttgctagtaa atgtggcagc agaatattca aaagaattaa ggcagattat tgcaaataaa 541 ggtgtcacca tacaaagggc acgatcatcc tctctctttg ttttgaagcg tgaaaatgcc 601 ctaaatttgg atccaccagt aattcccgat ggctatgaat taaggcaact ccagcaagaa 661 gatgccgaac ttgtccattc acattggccc aataaaaaag aaggttcatt ggactaccta 721 aagggtctaa tcgaaatcga tacaacgttt ggagtattca agaaagcgga caactcttta 781 attgcttgga tttttcgtaa cgagttcagt ggcctgggta tactacaagt tctagagtcc 841 gaacaacgaa aaggatttgg tacaattgta gtaaaagcaa taagttatgc cattgccaaa 901 actgaaagca tcaatatcac cgcgtggatt ctacttgaaa atgtaaaatc tcaaacgtta 961 tttcggaata ttggttttga agctcgtctt gttaatcagt ggattcaact caataaaatt 1021 gaataaaaca tagcagccca aggtatactg cgaattttta gcacatatag gctatttaaa 1081 ccaatgaaga agtagagttc aattatctta aataaacaac attttattaa ataattta