Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093152


LOCUS       XM_013260167            1138 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093152), mRNA.
ACCESSION   XM_013260167
VERSION     XM_013260167.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013260167.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1138
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1138
                     /gene="LOC106093152"
                     /note="uncharacterized LOC106093152; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106093152"
     CDS             115..1026
                     /gene="LOC106093152"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093152"
                     /protein_id="XP_013115621.1"
                     /db_xref="GeneID:106093152"
                     /translation="MSNGITKPEILRPLTEPELEELLQLYKQKYGIDSPQYLLIYNQC
                     KWNEKLKELKISDQNKKWISFRREFYTHAKGDFRTYGTYICLHQDLIQSVTFHTWQPD
                     FKELLECLDKTELICWQSGPLLVNVAAEYSKELRQIIANKGVTIQRARSSSLFVLKRE
                     NALNLDPPVIPDGYELRQLQQEDAELVHSHWPNKKEGSLDYLKGLIEIDTTFGVFKKA
                     DNSLIAWIFRNEFSGLGILQVLESEQRKGFGTIVVKAISYAIAKTESINITAWILLEN
                     VKSQTLFRNIGFEARLVNQWIQLNKIE"
     misc_feature    184..528
                     /gene="LOC106093152"
                     /note="Domain of unknown function (DUF5645); Region:
                     DUF5645; pfam18713"
                     /db_xref="CDD:436686"
     misc_feature    751..1005
                     /gene="LOC106093152"
                     /note="NAT (N-Acyltransferase) is a large superfamily of
                     enzymes that mostly catalyze the transfer of an acyl group
                     to a substrate and are implicated in a variety of
                     functions, from bacterial antibiotic resistance to
                     circadian rhythms in mammals. Members...; Region:
                     N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; cl17182"
                     /db_xref="CDD:473072"
     polyA_site      1138
                     /gene="LOC106093152"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aactacacgt ccagccatct ccacactacc gtcagtagta gttgcagaca attcagttcc
       61 aatcggcaaa ttatcgctac aaaagttaca aaatattcag ataacgacgc aataatgtca
      121 aacggcataa ctaagcctga aattttaagg cctctaactg aacctgaact tgaagaactt
      181 ttgcaactat ataaacaaaa atatggcatt gatagtcctc aatatctgct catctacaat
      241 cagtgtaaat ggaatgaaaa actaaaagaa ttgaaaatat cggatcaaaa taaaaaatgg
      301 atttcatttc gcagagaatt ttatacacat gcaaaaggtg actttaggac atacggtacc
      361 tatatatgtc tccatcaaga cttaatccaa agtgttacct ttcacacttg gcaaccggat
      421 tttaaagaat tattagaatg tctggacaaa actgaactga tatgttggca gagtggtcct
      481 ttgctagtaa atgtggcagc agaatattca aaagaattaa ggcagattat tgcaaataaa
      541 ggtgtcacca tacaaagggc acgatcatcc tctctctttg ttttgaagcg tgaaaatgcc
      601 ctaaatttgg atccaccagt aattcccgat ggctatgaat taaggcaact ccagcaagaa
      661 gatgccgaac ttgtccattc acattggccc aataaaaaag aaggttcatt ggactaccta
      721 aagggtctaa tcgaaatcga tacaacgttt ggagtattca agaaagcgga caactcttta
      781 attgcttgga tttttcgtaa cgagttcagt ggcctgggta tactacaagt tctagagtcc
      841 gaacaacgaa aaggatttgg tacaattgta gtaaaagcaa taagttatgc cattgccaaa
      901 actgaaagca tcaatatcac cgcgtggatt ctacttgaaa atgtaaaatc tcaaacgtta
      961 tttcggaata ttggttttga agctcgtctt gttaatcagt ggattcaact caataaaatt
     1021 gaataaaaca tagcagccca aggtatactg cgaattttta gcacatatag gctatttaaa
     1081 ccaatgaaga agtagagttc aattatctta aataaacaac attttattaa ataattta